Elucidating the protein interactome of the human ion channel TRPV4 A mutli-pronged approach to reveal the secrets of the fascinating N-terminal TRPV4 protein interactome in vitro and in cellulo Dissertation zur Erlangung des Grades "Doktor der Naturwissenschaften" im Promotionsfach Chemie am Fachbereich 09 - Chemie, Pharmazie, Geographie und Geowissenschaften der Johannes Gutenberg-Universität Mainz Erika Diehl née Pfeifer in Krasnoje, Republic of Moldova May 2021 Dekan: 1. Gutachterin: 2. Gutachterin: Tag des öffentlichen Promotionskolloquiums: 19.08.2021 D77 (Dissertation Universität Mainz) 3 Urheberschaftserklärung Ich, Erika Diehl (née Pfeifer), versichere, dass ich die vorliegende Dissertation mit dem Titel „Elucidating the protein interactome of the human ion channel TRPV4“ selbst verfasst, nicht andere als die in ihr angegebenen Quellen oder Hilfsmittel benutzt, alle vollständig oder sin- ngemäß übernommenen Zitate als solche gekennzeichnet sowie die Dissertation in der vor- liegenden oder einer ähnlichen Form noch bei keiner anderen in- oder ausländischen Hochschule anlässlich eines Promotionsgesuchs oder zu anderen Prüfungszwecken eingereicht habe. 4 Für meine Eltern, Familie und Freunde. Danke für Alles. "Nature always wins but that doesn’t mean we have to bow or grovel to it. That maybe even if we’re not always glad to be here, it’s our task to immerse ourselves anyway: wade straight through it, right through the cesspool, while keeping eyes and hearts open." - The Goldfinch, Donna Tartt 5 Abbreviations 4α-PDD 4α-phorbol-12,13-didecanoate 5’,6’-EET 5’,6’-epoxyeicosatrienoic acid A AA arachidonic acid ACN acteonitrile Abs absorbency AIP4 atropin-1-interacting protein 4 (ITCH) ATP adenosine triphosphate ALS amyotrophic lateral sclerosis AT1aR angiotensin receptor subtype 1a Avi avidin tag ABC ATP-binding casette B BSA bovine serum albumin BmrA Bacilus subtilis multidrug resistance ABC transporter ATP-binding Protein C CaM calmodulin CD circular dichroism cDNA complementary DNA CFP cyan fluorescent protein CTD C-terminal domain CV column volume(s) CMT2C Charcot-Marie-Tooth Type 2C D ddH2O double distilled water DDX3X DEAD (Asp-Glu-Ala-Asp) box RNA helicase 3 DNA desoxyribonulceic acid DSS disuccinimidyl suberate DTT dithiothreitol DAG diacyl glycerol DMF dimethylformamide E E. coli Escherichia coli EDTA ethylenediaminetetraacetic acid EM electron microscopy ER endoplasmatic reticulum F FA fetal akinesia F-BAR Fes/CIP4 homology Bin-Amphiphysin-Rvs FDAB Familialr digital arthropathy-brachydaxtyly FRET Förster resonance energy transfer G GO gene ontology GPCR G-protein coupled receptor GFP green fluorescence protein ggV4N Gallus gallus TRPV4 N-terminus H HEK293 cells human embrionic kidney 293 cells HECT homologous to E6-AP C-terminus His6-tag hexahistidine-tag hsV4N human TRPV4 N-terminus hsV4N Avi avidin-tagged human TRPV4 N-terminus hsV4 ARD human TRPV4 Ankyrin Repeat Domain HSQC heteronuclear single quantum coherence I IEX ion exchange chromatography IMAC immobilized metal ion chromatography IMS ion mobility spectrometry IP3 inositol-1,4,5-triphosphate IPTG isopropyl β-D-1-thiogalactopyranosid ITCH E3 ubiquitin-protein ligase Itchy homolog 6 IDR intrinsically disordered region ITC isothermal calorimetry M MRW mean residue weight MW molecular weight MS mass spectrometry / spectrometer MD metatropic dyplasia N NH amide group Ni2+-NTA Divalent nickel-nitrilotriacetic complex NMR nuclear magnetic resonance NTD N-terminal domain O OD600 optical density at 600 nm P PACSIN protein kinase C and PBD phosphoinositide binding domain casein kinase substrate in neurons PCR polymerase chain reaction PDB protein data bank PI(4,5)P2 Phosphatidylinositol-4,5-bisphosphate PLC Phospholipase C PKA Protein kinase A PM Plasma membrane PRR Proline rich region PPI protein-protein interaction PTM posttranslational modification R RNA ribonucleic acid dxRNA duplex ribonucleic acid RhoA Ras homolog family member A RBP RNA-binding protein RT room temperature RNP granule ribonucleoprotein granule S SDS-PAGE sodium dodecyl sulfate- SH3 Src homology domain 3 polyacrylamide gel electrophoresis PCC Pearson correlation coefficient SEC size exclusion chromatography SD standard deviation Strep-POD streptavidin-peroxidase SG stress granule T TMD transmembrane domain Tris Tris(hydroxymethyl)aminomethane TRP transient receptor potential Tx100 TritonX-100 TOF Time-of-flight U UDMSE ultra high-definition mass spectrometryE W wt wild type/ wild typic X XL-MS cross-linking mass spectrometry Y Y2H yeast-two hybrid 7 Summary Transient receptor potential vanilloid 4 (TRPV4) is an integral membrane protein which func- tions as a non-selective cation channel. TRPV4 plays a central role in mammalian sensory perceptions like the sense of touch and temperature sensing. Although research steadily in- creases, our knowledge of TRPV4 as well as other TRP superfamily members and their com- plex regulation mechanisms still remain poorly understood. TRPV4 is also involved in not well- characterized diseases, including peripheral neuropathies and skeletal dysplasias caused by channel point mutations. Many of these point mutations are located in the human TRPV4 N- terminus (hsV4N). The either solely skeletal or neuronal impact of these mutations led to the assumption that hsV4N may interact with tissue specific proteins and that these protein-protein interactions would then be specifically disturbed in the presence of disease-causing point mu- tations. To this point, data on the protein interactome of hsV4N are fragmentary and further investigations to shed light on the complex interaction network of TRPV4 are required. In this work, recombinant hsV4N as well as the TRPV4 ankyrin repeat domain (hsV4 ARD), as a part of hsV4N and notorious hot-spot for disease causing mutations, were investigated with regard to their protein interactome in HEK293 cells using ultra high-definition mass spec- trometry (UDMSE) in cooperation with the RG (University Medicine Mainz, JGU Mainz). The interactome results revealed ribonucleotide binding proteins as a new potential class of TRPV4 interacting proteins and indicate hsV4N as an until now unkown hub in the regulatory mechanism of cytoplasmic ribonucleoprotein granule formation. These findings were under- lined by the here shown direct interaction in vitro between recombinant hsV4 ARD and the granule nucleating protein DDX3X. Interestingly, this interaction increased in the presence of the neuropathy-causing R232C mutation in hsV4 ARD. Another hsV4 ARD interacting protein studied in the course of this thesis is the small GTPase RhoA. It was shown via nuclear magnetic resonance spectroscopy (NMR) that recombinantly expressed 15N-RhoA directly interacts with hsV4 ARD and that this interaction significantly decreases in the presence of the neuropathy-causing mutation R269C in hsV4 ARD (hsV4 8 ARD R269C). In a cooperation with the RG (Department of Neurology, Johns Hopkins University School of Medicine) it was shown that this neuropathy mutation-dependent loss-of- interaction leads to aberrant neurite-growth in cellulo and Drosophila melanogaster. These findings strongly hint at that the disruption of TRPV4-RhoA interaction is one determinant of the tissue-specific toxicity of TRPV4 neuropathy mutations. An additional determinant for the tissue-specific toxicity of TRPV4 neuropathy mutations could be the loss-of-interaction between neuropathy-causing TRPV4 R269C and the neurospecific protein and known direct TRPV4-binding partner PACSIN1 that was demonstrated in this work. PACSIN1 dampens hypotonicity-induced TRPV4-dependent Ca2+-influx in transiently trans- fected HEK293 cells. This ability to desensitize TRPV4 to hypotonicity is lost in the presence of the neuropathy-causing mutation TRPV4 R269C, probably due to a loss-of-interaction as shown via co-immunoprecipitation. Strikingly, the PACSIN1-orthologue PACSIN3 retained its TRPV4 interaction and modulation upon hypotonicity. Further comprehensive studies with PACSIN chimeras hint towards different binding mechanisms between TRPV4 and PACSIN1 or TRPV4 and PACSIN3, respectively. Furthermore, in this thesis the foundation was laid to elucidate the possible role of post-translational modifications in TRPV4s protein-protein interactions. It was shown that hsV4N directly interacts with the E3 ubiquitin ligase ITCH and that lysine residues in close proximity to important regu- latory sites within the intrinsically disordered region (IDR), preceding the hsV4 ARD in hsV4N, are ubiquitinated. Thus this thesis provides a comprehensive study of new potential TRPV4 protein interactors and first explanations for the tissue-specificity of neuropathy-causing TRPV4 mutations. 9 Zusammenfassung Transient receptor potential vanilloid 4 (TRPV4) ist ein integrales Membranprotein, das als nicht- selektiver Kationenkanal fungiert. TRPV4 spielt eine zentrale Rolle bei Sinneswahrnehmungen von Säugetieren wie dem Tastsinn und der Temperaturwahrnehmung. Obwohl die Forschung über TRP-Kanäle stetig zunimmt, ist unser Wissen über TRPV4 sowie über andere Mitglieder der TRP-Superfamilie und deren komplexe Regulationsmechanismen noch immer wenig ver- standen. TRPV4 ist auch an nicht gut charakterisierten Krankheiten beteiligt, darunter periphere Neuropathien und skeletale Dysplasien, die durch Punktmutationen im Kanal verursacht wer- den. Viele dieser Punktmutationen befinden sich im N-Terminus von humanem TRPV4 (hsV4N). Die entweder ausschließlich skeletale oder neuronale Auswirkung dieser Mutationen führte zu der Annahme, dass hsV4N mit gewebespezifischen Proteinen interagieren könnte und dass diese Protein-Protein-Interaktionen bei Vorhandensein von krankheitsverursachenden Punkt- mutationen dann spezifisch gestört sein würden. Bis zu diesem Zeitpunkt sind die Daten über das Proteininteraktom von hsV4N lückenhaft und weitere Untersuchungen, die mehr Klarheit über das komplexe Interaktionsnetzwerk von TRPV4 bringen sollen, sind erforderlich. In dieser Arbeit wurden rekombinantes hsV4N sowie die TRPV4-Ankyrin-Repeat-Domäne (hsV4- ARD), als Teil von hsV4N und notorischer hot spot für krankheitsverursachende Mutationen, hinsichtlich ihres Proteininteraktoms in HEK293-Zellen mittels Ultra-High-Definition-Massenspek- trometrie (UDMSE) in Kooperation mit der RG (Universitätsmedizin Mainz, JGU Mainz) untersucht. Die Interaktom-Ergebnisse enthüllten Ribonukleotid bindende Proteine als eine neue potentielle Klasse von TRPV4-interagierenden Proteinen und weisen darauf hin, dass hsV4N ein bisher unbekannter Knotenpunkt im Regulationsmechanismus von der Bildung von zyto- plasmatischen Ribonukleoproteingranula sein könnte. Diese Erkenntnisse wurden durch die hier gezeigte direkte Interaktion in vitro zwischen rekombinantem hsV4 ARD und dem Granu- la nukleierenden Protein DDX3X untermauert. Interessanterweise verstärkte sich die Protein- Protein-Interaktion von DDX3X mit hsV4 ARD in Gegenwart der neuropathieverursachenden R232C-Mutation in hsV4 ARD. 10 Ein weiteres hsV4 ARD interagierendes Protein, das im Rahmen dieser Arbeit untersucht wur- de, ist die kleine GTPase RhoA. Mittels Kernspinresonanzspektroskopie (NMR) wurde gezeigt, dass rekombinant exprimiertes 15N-RhoA direkt mit hsV4 ARD interagiert und dass diese In- teraktion in Gegenwart der Neuropathie verursachenden Mutation R269C in hsV4 ARD (hsV4 ARD R269C) signifikant abnimmt. In einer Kooperation mit der RG (Department of Neurology, Johns Hopkins University School of Medicine) konnte gezeigt werden, dass die- ser mutationsabhängige Interaktionsverlust zu aberrantem Neuriten-Wachstum in cellulo und Drosophila melanogaster führt. Diese Befunde weisen stark darauf hin, dass die Störung der TRPV4-RhoA-Interaktion eine Determinante für die gewebespezifische Toxizität von TRPV4- Neuropathie-Mutationen ist. Eine weiterer wichtiger Faktor für die gewebespezifische Toxizität von TRPV4-Neuropathiemuta- tionen könnte der hier gezeigte Verlust der Interaktion zwischen der Neuropathie verursachen- den TRPV4 R269C und dem neurospezifischen Protein und bekannten direkten TRPV4-Bin- dungspartner PACSIN1 sein. PACSIN1 schwächt den Hypotonie induzierten TRPV4-abhängigen Ca2+-Influx in transient transfizierten HEK293-Zellen ab. Diese Fähigkeit, TRPV4 gegenüber Hypotonie zu desensibilisieren, geht in Gegenwart der Neuropathie verursachenden Mutation TRPV4 R269C verloren Dies geschieht wahrscheinlich aufgrund eines Interaktionsverlustes, wie durch Co-Immunopräzipitation gezeigt werden konnte. Auffallend ist, dass das PACSIN1- Ortholog PACSIN3 seine TRPV4-Interaktion und -Modulation bei Hypotonie beibehielt. Weitere umfangreiche Untersuchungen mit PACSIN-Chimären deuten auf unterschiedliche Bindungs- mechanismen zwischen TRPV4 und PACSIN1 bzw. TRPV4 und PACSIN3 hin. Weiterhin wurde in dieser Arbeit der Grundstein gelegt, um die mögliche Rolle von posttransla- tionalen Modifikationen in den Protein-Protein-Interaktionen von TRPV4 aufzuklären. Es konnte gezeigt werden, dass hsV4N direkt mit der E3-Ubiquitin-Ligase ITCH interagiert und dass Ly- sinreste in unmittelbarer Nähe zu wichtigen regulatorischen Stellen innerhalb der intrinsisch ungeordneten Region (IDR), die der hsV4-ARD in hsV4N vorgelagert ist, ubiquitiniert sind. Somit liefert diese Arbeit eine umfassende Studie neuer potentieller TRPV4-Proteininteraktoren und erste Erklärungen für die Gewebespezifität der Neuropathie verursachenden TRPV4-Muta- tionen. 11 12 Contents Contents 1 Introduction 17 1.1 A little grasp of the TRP channel world . . . . . . . . . . . . . . . . . . . . . . . 17 1.2 TRPV4 - the wild child amongst TRPV channels? . . . . . . . . . . . . . . . . . 21 1.3 Human TRP channels and their protein networks - glimpses of a brave new world 25 1.4 Aim of this thesis - taming the wild child TRPV4 . . . . . . . . . . . . . . . . . . 27 2 Materials 29 2.1 Chemicals . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 2.2 Buffer and solutions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31 2.3 Enzymes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41 2.4 Antibodies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 42 2.5 Oligonucleotides . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 43 2.6 Plasmids and expression constructs . . . . . . . . . . . . . . . . . . . . . . . . 46 2.7 Peptide and protein characteristics . . . . . . . . . . . . . . . . . . . . . . . . . 52 2.8 Kits . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54 2.9 Media and supplements for cell culture . . . . . . . . . . . . . . . . . . . . . . . 55 2.10 Cells . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 2.11 Laboratory equipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56 2.12 Software . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 3 Methods 59 3.1 General methods . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 3.1.1 Heat-shock transformation of E. coli bacteria . . . . . . . . . . . . . . . 59 3.1.2 Plasmid DNA preparation from E. coli . . . . . . . . . . . . . . . . . . . 59 3.1.3 Polymerase chain reaction (PCR) . . . . . . . . . . . . . . . . . . . . . 59 3.1.4 Gibson Assembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 3.1.5 Agarose gel electrophoresis . . . . . . . . . . . . . . . . . . . . . . . . 61 13 Contents 3.1.6 DNA sequencing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 3.1.7 SDS polyacrylamide gel electrophoresis (SDS-PAGE) . . . . . . . . . . 61 3.1.8 Western blot and chemiluminescence detection . . . . . . . . . . . . . . 62 3.1.9 Protein quantification . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63 3.1.10 Size exclusion chromatography . . . . . . . . . . . . . . . . . . . . . . . 64 3.2 Cell culture of eukaryotic cells . . . . . . . . . . . . . . . . . . . . . . . . . . . 64 3.2.1 Cultivation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64 3.2.2 Transient transfection of HEK293T cells . . . . . . . . . . . . . . . . . . 65 3.2.3 Stable transfection of HEK293 cells . . . . . . . . . . . . . . . . . . . . 66 3.3 Immunostaining and fluorescence microscopy . . . . . . . . . . . . . . . . . . . 67 3.4 Co-Immunoprecipitation in eukaryotic cells . . . . . . . . . . . . . . . . . . . . 68 3.5 Live Ca2+ imaging . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 3.6 Ca2+ influx assay . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 3.7 Recombinant expression and purification of constructs . . . . . . . . . . . . . . 70 3.7.1 Recombinant expression of human N-terminal TRPV4 (hsV4N) constructs 70 3.7.2 Purification of hsV4N constructs . . . . . . . . . . . . . . . . . . . . . . 71 3.7.3 Purification of hsV4∆N122 and hsV4∆N132 constructs . . . . . . . . . 71 3.7.4 Biotinylation and purification of hsV4N constructs . . . . . . . . . . . . . 72 3.7.5 Recombinant expression and purification of human RhoA . . . . . . . . 72 3.7.6 Recombinant expression and purification of human DDX3X_aa122-582 (DDX3X) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 3.7.7 Recombinant expression and purification of human ITCH . . . . . . . . . 74 3.7.8 Recombinant expression and purification of human ITCH WW domains . 75 3.7.9 Recombinant expression and purification of human YAP-WW domains . 75 3.8 Pulldown assay of biotinylated hsV4N constructs . . . . . . . . . . . . . . . . . 76 3.9 Mass spectrometry . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 3.9.1 In gel digestion . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 3.9.2 In-solution digestion . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78 3.9.3 Liquid Chromatography Mass Spectrometry . . . . . . . . . . . . . . . . 78 3.9.4 Data Processing and Protein Identification . . . . . . . . . . . . . . . . . 79 3.10 Enzymatic assays . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 3.10.1 GTPase assay . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 3.10.2 ATPase assay . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 3.10.3 Ubiquitinylation assay . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 14 Contents 3.11 Blue Native-PAGE (BN-PAGE) . . . . . . . . . . . . . . . . . . . . . . . . . . . 82 3.12 Circular dichroism (CD) spectroscopy . . . . . . . . . . . . . . . . . . . . . . . 82 3.13 NMR spectroscopy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 3.14 Cross-linking mass spectrometry (XL-MS) . . . . . . . . . . . . . . . . . . . . . 83 4 Results 84 4.1 A beginning to elucidate the versatile TRPV4 N-terminal protein interactome - the tip of the iceberg . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 84 4.1.1 Purification of biotinylated TRPV4 N-terminal proteins . . . . . . . . . . . 84 4.1.2 The TRPV4 N-terminal protein interactome in HEK293 cells derived via mass spectrometry . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87 4.2 Birds of a feather flock together - the interaction between the two protean proteins TRPV4 and DDX3X . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 4.3 It is all about humanity - an in cellulo study of the interaction between human TRPV4 and PACSIN1-3 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112 4.4 Small but powerful - the small GTPase RhoA interacts with the TRPV4 Ankyrin Repeat Domain . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 120 4.5 All or nothing - interaction of ITCH requires the full TRPV4 N-terminus in vitro . . 126 4.6 TRPV4 and the actin cytoskeleton - connecting scientific disciplines . . . . . . . 133 5 Conclusion & Outlook 138 6 Appendix 143 6.1 Appendix - Introduction . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 143 6.2 Appendix - Purification of biotinylated TRPV4 N-terminal proteins . . . . . . . . 152 6.3 Appendix - A beginning to elucidate the versatile TRPV4 interatcome . . . . . . 152 6.4 Appendix - The interaction between the two protean proteins TRPV4 and DDX3X 177 6.5 Appendix - An in cellulo study of the interaction between human TRPV4 and PACSIN1-3 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 178 6.6 Appendix -The small GTPase RhoA interacts with the TRPV4 Ankyrin Repeat Domain . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 183 6.7 Appendix - Interaction of ITCH requires the full TRPV4 N-terminus in vitro . . . . 184 6.8 Appendix - TRPV4 and the actin cytoskeleton - connecting scientific disciplines . 192 6.9 Appendix - Establishing HEK293 cell lines stably expressing TRP channels . . . 201 6.10 Appendix - Purification of ITCH WW domains . . . . . . . . . . . . . . . . . . . 202 15 Contents 6.11 Appendix - Purification of YAP1 WW domains . . . . . . . . . . . . . . . . . . . 203 6.12 Appendix - Amino acid and DNA sequences . . . . . . . . . . . . . . . . . . . . 204 7 List of Figures 225 8 List of Tables 227 9 Bibliography 230 16 Chapter 1. Introduction 1 Introduction 1.1 A little grasp of the TRP channel world TRP stands for Transient Receptor Potential - a term introduced by Cosens et al. in a pub- lication with the title "Abnormal Electroretinogram from a Drosophila Mutant".1 In this paper, Cosens et al. described tran- TRPC2 sient instead of steady electric (mouse) TRPM1 TRPM3 TRPM6 TRPC7 activities in Drosophila melano- TRPC3 TRPM7 TRPC6 gaster retinas upon light stim- TRPM4 TRPC5 uli, caused by a spontaneous TRPM5 TRPC4 mutation in these flies. It took another 20 years to identify TRPM2TRPC1 and characterize the respon- TRPM8 TRPP2 sible Drosophila melanogaster trp gene locus and to show TRPA1 TRPP1 that this gene encodes for TRPV5 an integral membrane protein. TRPP3 In 1992 Baruch Minke and TRPV6 TRPML3 Roger Hardie showed this in- TRPV3 TRPML2 TRPV4 tegral membrane protein to be TRPML1 TRPV2 TRPV1 a Ca2+-gating ion channel.5 Figure 1.1: Multiple alignment phylogenetic tree of the mammalian TRP chan- The identification of mam- nel superfamily. The phylogenetic tree shows the relations between the TRP subfamilies based on sequence similarity. TRPP (polycystin), TRPC (canonical), malian TRP channels not just TRPM (melastatin), TRPA (ankyrin), TRPV (vanilloid) and TRPML (mucolipin). Note only founded a whole new pro- that TRPC2 is a pseudogene in humans and therefore was substituted with the mouse variant. Multiple sequence alignment and phylogenic tree generation was tein superfamily, consisting of performed with ClustalW2 at the EMBL-EBI server.2 Tree Rendering was performed 28 members divided into 6 sub- with DrawTree 3.66 via http://www.phylogeny.fr/.3,4 families (figure 1.1) - intensive 17 Chapter 1. Introduction investigations also underpinned again a common catch in biochemical nomenclature: the initial name often underestimates the plethora of physiological functions the proteins are covering - and the TRP superfamily is a remarkable example for this.6 TRP channels are expressed at the plasma membrane and/or in intracellular organelle mem- branes of almost every cell and tissue type. With their function as tetrameric cation channels and slight preference for Ca2+, TRP channels play an important role in different physiological processes including muscle contraction, cell proliferation or neurotransmitter release.6 In addi- tion, since they couple intra- and extracellular signals to flux ions across the membrane, TRP channels are also important mediators between the two membrane sides and are therefore well suited to fulfill their role in somato-, osmo-, thermo- and photosensation as well as nocicep- tion, amongst others sensory perceptions.7–13 In cellulo experiments revealed a broad diversity among TRP channel activating/modulating stimuli, including ligand activation by exogenous synthetic and natural chemical compounds or endogenous lipids and purine nucleotides as well as temperature and cell swelling. This polymodality hints towards to a highly complex and diverse regulation of TRP channels, defining their (patho)physiological role by the respective cellular context in terms of the lipid- and proteome, for example. As diverse as the activa- tion stimuli and physiological roles are the pathological outcomes of mutated TRP channels - diseases which can be grouped into so called channelopathies.14–17 TRP channelopathies span from kidney disorders (e.g. focal segmental glomerusclerosis, TRPC6 OMIM:603965, polycystic kidney disease, TRPP2 OMIM:613095), skeletal dyplasias (e.g. metatropic dypla- sia, TRPV4 OMIM:156530), lysosomal storage disorders (e.g. mucolipidosis type 4, TRPML1 OMIM:252650), skin disorders (e.g. erythrokeratodermia veriabilis et progressiva 6, TRPM4 OMIM: 618531) to neurodegenerative disorders (e.g. hereditary motor and sensory neuropathy type IIC, TRPV4 OMIM:606071). TRP channels share structural motifs among each other, but also exhibit structural diversity - especially between the different TRP subfamilies. Each TRP monomer consists of struc- turally conserved six transmembrane helices (S1-6) with a so-called reentrant loop between S5 and 6, forming the ion pore in a TRP tetramer (figure 1.2 A). S1-4 form the so-called voltage sensor-like domain (VSLD), which affects channel gating by ligand binding.18–20 The biggest structural differences between TRP channels are displayed within the intracellular N- and C- termini as well as by large extracellular domains present in some subfamilies. Due to these differences, the mammalian TRP superfamily can be divided into two groups. Group 1 (TRPM, TRPA, TRPV and TRPC, figure 1.2 B) includes the TRP subfamilies with large cytosolic N- termini, 18 Chapter 1. Introduction Group 1 Reentrant loop extracellular TRPV6 TRPA1 PDB:6d7s PDB:6pqq S1-4 S5-6 S1-4 S5-6 membrane intracellular N C Group 2 extracellular/ luminal TRPML1 TRPP2 TRPC3 TRPM2 PDB:5wj5 PDB:5t4d PDB:6djr PDB:6mix membrane intracellular Figure 1.2: One representative structure of each human TRP subfamily. A Each TRP monomer consists of a structurally conserved core of six transmembrane helices (S1-6) shown here as ribbon diagram (left) and topolgy model (right). B Selected members belonging to group 1 of human TRP subfamilies, including TRPV6, TRPA1, TRPC3 and TRPM2. Monomers are high- lighted in violet. For TRPV6, TRPA1 and TRPC3, only the ankyrin repeat domains (which are mostly α-helical structures) of the whole cytosolic N-terminus of respective TRP channel are resolved. The preceding parts are putatively unstructured and therefore not resolved in shown structures. For TRPM2 and the other TRPM channels a large so-called melastatin homology region defines the N-terminus.21–24 C Selected members belonging to group 2 of human TRP subfamilies, including TRPML1 and TRPP2 with their extracelluar/luminal domains spanning from the S1 to S2 transmembrane helix. harboring pivotal regulatory sites like lipid binding sites or regulatory domains like ankyrin repeat domains (ARDs). ARDs are α-helical motifs which serve as protein interaction platforms and play a role in ion channel assembly.25–28 Group 2 TRP channels (TRPP amd TRPML, figure 1.2 C) are characteristic for their large domains spanning from S1 to S2, either being called extracellular domain or extraluminal domain in the case of lysosomal localization of TRPML. While structural investigations of (human) TRP channels immensely advanced in the past 10 years, the elucidation of human TRP channel protein interactomes is still underrepresented.20 Figure 1.3 shows current protein-protein interaction (PPI) networks deposited in the manually curated TRP channel PPI database TRIP.29,30 Strikingly, most of the shown PPIs were deter- mined with rodent proteins, whereas only a minority depicts PPIs with human proteins (see also table 6.1). Besides the prominent Ca2+-binding protein Calmodulin and other calcium sensors like ALG-2 and NCS-1, especially cytoskeletal associated (KIF3A, α-actinins, Tropomyosin 1) and scaffolding proteins (AKAP5, NHERF-1, Homer-1) are represented. Furthermore, interac- tors like Orai1, IP3R3 and RyR underline the role of TRP channels in store operated Ca2+ entry. Most of these proteins are part of large protein complexes to achieve physiological func- 19 Chapter 1. Introduction tions and tightly regulate each other. As aberrant human TRP channels are the cause of sev- eral, also tissue and cell-specific diseases, it is pivotal to determine these protein complexes and ultimately also the regulation mechanisms between distinct PPIs to understand the patho- physiological outcomes of mutated TRP channels. Here, the N- and C-termini of TRP channel are especially interesting, as they harbor important interaction sites like ankyrin repeat domains but also TRPP are accessible for a broad range of possible protein interactors due TRPC TRPM to their cytosolic protrusion (figure 1.2 B). Almost all PPI studies with TRP channels were conducted with TRPA1 full-length channels. Additionally TRPML to the need for a more compre- TRPV hensive knowledge of overall TRP channel PPIs, it is also pivotal to = human determine the exact interaction sites = mouse/rat at the channels. This leads to a Figure 1.3: TRP channel PPI network extracted from the TRIP Database. better understanding of these PPIs The majority of the shown PPIs are with rodent proteins (grey nodes), whereas and ultimately provide modulation only a minority depicts PPIs with human proteins (purple nodes). Node colors of TRP subfamilies are indicated in the figure. See figure 6.1 for labeled nodes. possibilities of aberrant PPIs due Network was rendered via with Cytoscape 3.8.0. to mutated TRP channels in dis- 29,30 eases. 20 Chapter 1. Introduction 1.2 TRPV4 - the wild child amongst TRPV channels? In their review "The puzzle of TRPV4 channelopathies" published in 2013, Bernd Nilius and Thomas Voets described TRPV4 as follows: "TRPV4 could be compared to Proteus, a God of the sea in Greek mythology, who has characteristics of flexibility, versatility, mutability and adaptability, emerges in many shapes and can appear in frightening forms."31 This description is still surprisingly accurate, as in the course of this PhD thesis TRPV4 showed another similarity to the sea god. Proteus is able to prophecy the future but is almost unwilling to do so. Only to the ones who are able to capture him with cunning, Proteus will answer their questions. And just as this moody sea god, TRPV4 is unwilling to easily reveal information about its role in physiological and pathological processes. This PhD thesis shows that it took, and it is still going to take, scientific highly versatile and multi-pronged approaches to "capture" TRPV4 to get the desired information. TRPV4 was first described as an osmoreceptor involved in systemic osmotic pressure in 2000 by Liedtke et al.32 Three years later, two research teams generated trpv4 null mice and pub- lished the outcomes of this deletions in the murinal osmotic regulation.33,34 Liedtke and Fried- mann determined systematic plasma hyperosmolality, diminished drinking and decreased va- sopressin plasma levels in these mice. Vasopressin is a peptide hormone synthesized in the hypothalamus and systematically released via the posterior pituitary in response to hyperos- molality, inducing water reabsorbtion in the nephrons and arteriole constriction to increase the peripheral vascular resistance and arterial blood pressure. Therefore, Liedtke and Friedmann suggested that trpv4 null mice have an impaired osmosensation in the central nervous sys- tem (CNS).33 In contrast, Mizuno et al. observed a normal drinking behavior in their trpv4 null mice and no plasma hyperosmolality. Furthermore, upon a hyperosmolal challenge due to intraperitoneal propylene glycol injection, these mice showed increased vasopressin secre- tion compared to wild type mice.34 Taken together, these studies and later conducted in cellulo experiments show that TRPV4 is a pivotal key regulator in osmosensation - but how exactly TRPV4 is involved in the vasopression-regulated osmolality homeostasis or even in the smaller cellular context of osmolarity induced cell swelling or shrinkage still remains elusive. These first descriptions of TRPV4 as a osmotically activated channel were then followed by the dis- coveries of other TRPV4 activation and/or modulating factors such as innocuous temperature, 21 Chapter 1. Introduction chemicals like the synthetic phorbol ester 4α-phorbol-12,13-didecanoate (4α-PDD) or the en- dogenous compound 5’,6’-epoxyeicosatrienoic acid (5’,6’-EET) as well as plasma membrane embedded phosphoinositides like phosphatidylinositol-4,5-bisphosphate (PI(4,5)P2).35–39 Considering the relatively mild phenotypic consequences of trpv4 null mice, resulting in fer- tile and viable mice with some impairments like the before mentioned altered osmosensa- tion, impaired osteoclast differentation as well as hearing alteration and compromised vas- cular endothelial functions, it is striking that mutations in TRPV4 lead to severe diseases in humans.31,40–45 These autosomal-dominant hereditary TRPV4 channelopathies span from rel- atively mild outcomes to heavily disabling or even lethal diseases which can be divided in two main groups, namely skeletal dysplasias and peripheral neuropathies.14,15,31,46 Figure 1.4: Distribution of TRPV4 channelopa- thy mutations. Shown residues of channelopathy- causing TRPV4 mutations are mapped onto the cryo-EM structure of X. tropicalis TRPV4 (PDB:6BBJ). Skeletal dysplasia mutants are shown as green spheres, familial digital arthropa- thy brachydactyly (FDAB) mutations as blue spheres and peripheral neuropathy mutations as yellow spheres. Whereas skeletal dysplasia mu- tations are distributed over the whole channel, neuropathy-causing mutations are mainly clustered K276E in the cytosolic ankyrin repeat domain (hsV4 ARD). R232C Numbered mutations correspond to the human R269C TRPV4 sequence and were investigated in the course of this thesis. The very N-terminal intrinsi- cally disordered region (IDR, aa 1-149) is not re- N solved and therefore not shown in the structure. Skeletal dyplasias Please note that a human TRPV4 structure, also FDAB Periph. neuropathies lacking the IDR, was published by Botte et al., but no structure was deposited in the RSCB Protein Data Bank to date.18 To date, five skeletal dysplasias and one other skeletal disease (familial digital arthropathy brachydactyly, FDAB, OMIM: 606835) are known to be caused by TRPV4 mutations (OMIM: 605427). FDAB represents a very mild form of a TRPV4 mutation-induced bone disease, where patients appear normal at birth but develop a deforming and painful osteoarthrithis due to sub- chondral pathology of the finger- and toe phalanges as well as the metacarpal and -tarsal bones, leading to arthropathy and brachydactyly. The FDAB-causing mutations in TRPV4 which are known to date, were discovered in three unrelated families in the third ankyrin repeat (AR3) 22 Chapter 1. Introduction of TRPV4 (G270V, R271P, F273L, see also blue spheres in figure 1.4).47 Unlike these FDAB- associated mutations, skeletal dysplasia-causing mutations are not as tightly clustered in one specific TRPV4 domain (figure 1.4). However, in sequential proximity, mutations (K276E or I331F) lead to lethal metatropic dysplasia (MD), the severe end of TRPV4 channelopathies.48,49 Characteristic TRPV4-associated skeletal dysplasia phenotypes are brachydactyly, short trunk and scoliosis.31 For lethal MD, additionally abnormally thick cartilage and congenital bone de- formations were observed like hip dislocation and clubfeet, probably caused by altered endo- chondral ossification during the fetal development.49 Recombinant overexpression - either in HEK293T cell lines or Xenopus tropicalis oocytes - of skeletal dysplasia-inducing TRPV4 mu- tations resulted mostly in gain-of-function channels, leading to increased Ca2+-levels in these cells.50–52 The same observations in terms of elevated basal or activated Ca2+-influx activity were also made with neuropathy-causing TRPV4 mutations.53,54 TRPV4-associated peripheral neuropathies include two rare forms of spinal muscle arthropies (SMAs), namely congenital distal SMAs (CDSMAs, OMIM:600-175) and scapuloperoneal SMA (SPSMA, OMIM:181405). In most cases (approx. 90 %), the cause of SMA is a mutation in the survival of motorneu- ron 1 (SMN1) protein, leading to ventral horn motor neuron degeneration and ultimately to progressive muscle wasting of voluntary muscles in the limbs and also respiratory muscles.55 TRPV4-associated CDSMA and SPSMA primarily affect the muscles of lower limbs and for SPSMA additionally the shoulder blade muscle. While TRPV4-associated CDSMA patients do not have sensory deficits, SPSMA and the third TRPV4-associated neuropathy, Charcot-Marie- Tooth Type 2C (CMT2C, OMIM:606071), share sensory deficits and vocal cord paresis as symp- toms. Furthermore, CMT2C patients show, in contrast to the congenital conditions in CDSMA and SPSMA, a progressive and non-congenital muscle weakness and atrophy of distal muscles. Strikingly, mutations causing the before mentioned peripheral neuropathies especially cluster in ankyrin repeats 2 and 4 of the TRPV4 ankyrin repeat domain, whereas skeletal dyplasia causing mutations are spread all over the full-length channel, as shown in figure 1.4.27,31,49,56Amongst the TRPV subfamily, only TRPV4 exhibits such a plethora of direct disease-causing mutations. To date, only two other clinical syndromes are known to be caused by TRPV subfamily mem- bers. TRPV3 is the until now only known cause of the Olmsted syndrome (mutilating palmo- plantar keratoderma with periorificial keratotic plaques, OMIM: 614594), a very rare congenital skin disorder leading to very thick skin on the hand palms and feet soles combined with severe hyperkeratotic plaques around the mouth region. Olmsted syndrome-causing TRPV3 mutations are either located in the loop between transmembrane helices S4 and 5 (G537S and G573C) or in the C-terminus (W629G) and also result, like the disease-causing mutations in TRPV4, in 23 Chapter 1. Introduction gain-of-function channels. On the other hand, most of the TRPV6 mutations leading to tran- sient neonatal hyperparathyroidism (OMIM:618188) are loss-of-function mutations spread all over the full-length channel.57 The impaired placental TRPV6 mediated Ca2+ influx induces fetal hypocalcemia, leading to a secondary hyperparathyroidism where too much parathyroid hormone (PTH) is secreted. The consequence is a metabolic bone disease in affected infants, who present prenatal fractures, malformation of long bones and shortened ribs. In contrast to other TRPV channel-associated diseases where treatment is exclusively symptomatic, post- natal recovery was observed after oral Ca2+ supplementation.57 These findings underline the importance of the TRPV ion flux fine tuning in respective tissues. TRPV channels can be di- vided into two groups: thermosensitive and polymodal TRPVs (TRPV1-4), which show a low basal ion channel activity and comparable low Ca2+ ion selectivity in comparison to the sec- ond group, consisting of TRPV5 and 6. The latter two are Ca2+ selective with a constituent activity and are not ligand-gated. It was shown that calmodulin (CaM) regulates TRPV5 and 6 in a negative, Ca2+-influx dependent feedback loop by blocking the cytosolic side of the ion pore.58,59 Regarding the disease severity of TRPV4 gain-of-function mutations, TRPV4 seems to be the wild child amongst the TRPV channels. The tissue-specificity of TRPV4-associated diseases hints towards a vulnerability of these tissues due to the higher TRPV4-mediated Ca2+- influx. Systemic antagonism of TRPV4 with the highly selective TRPV4 antagonist HC-067047 in mice lead to no severe side effects regarding parameters like motor coordination, fluid intake, heart rate and thermoregulation.60 Additionally, the orally available, highly selective TRPV4 an- tagonist GSK2798745 was recently examined in a phase I clinical trial in healthy subjects and patients with cardiogenic pulmonary edema (NCT02119260). TRPV4 plays a central role in pul- monary capillary endothelium, where the ion channel has a critical role in the development of high pulmonary venous pressure (PVP)-associated lung edema after heart-failures. Pulmonary capillary endothelial TRPV4 gets activated upon high PVP, leading to a reduced alveolar bar- rier due to endothelial cell detachment in lungs. As a consequence, the pulmonary capillar- ies show increased fluid (blood plasma) permeability and this leads ultimately to pulmonary edema.61,62 GSK2798745 was well tolerated by healthy subjects and patients in terms of no detectable changes in vital and clinical laboratory parameters. However, pulmonary edema patients showed shortness of breath and reduced exercise tolerance upon GSK2798745 treat- ment. Nevertheless, the patients did not show disease worsening. GSK2798745 laid there- fore the foundation for a possible, future systemic TRPV4-antagonism in human diseases.61 As trpv4 null mice just show mild phenotypes as mentioned above and systemic, pharmaceu- tically administrated TRPV4 antagonism seems to be well tolerated in mice and humans, it 24 Chapter 1. Introduction is hypothesized that TRPV4-mediated Ca2+-influx can be compensated with other ion chan- nels (or in the case of TRPV6-associated neonatal hyperparathyroidism even with nutritional supplementation), but uncontrolled Ca2+-influx leads to pathophysiological consequences in disease-related tissues. Several mechanisms were proposed, coupling TRPV4 mutations with disease pathology, like calcium-induced cell death or altered neuritogenesis.31 But ultimately, all these hypotheses aim towards either altered gene expression, probably through a Ca2+/CaM- dependent pathway or altered protein-protein interactions between TRPV4 and cell-type spe- cific protein complexes. Especially for the neuropathy-causing mutations, which mainly cluster in the cytosolic TRPV4 N-terminus, altered tissue-specific PPIs could be the reason for the neurospecificity of these mutations. 1.3 Human TRP channels and their protein networks - glimpses of a brave new world In the last decades, several high-throughput methods to identify protein interactomes emerged and were optimized continuously, such as protein-fragment complementation assay screens (PFCAs) like the yeast two-hybrid assay (Y2H) or mass spectrometry (MS) approaches. PF- CAs map binary PPIs in the context of defined libraries of probable interactors, whereas MS approaches can provide qualitative and quantitative information of PPIs in complex protein networks.63,64 The characterization of ion channel interactomes with MS-based proteomics greatly contributed to a better understanding of these supramolecular complexes, like for the glutamate receptors of the AMPA-type (AMPARs).65–67 AMPARs are cation channels localized in the central nervous system, where they are involved in signal transmission in glutamatergic synpases. AMPARs are activated by the neurotransmitter glutamate, but also by the synthetic glutamate analog AMPA.67 Based on classical molecular cloning, AMPARs were assumed to consist of four GluA transmembrane proteins, which are surrounded by up to four auxiliary subunits, which are either the so called transmembrane AMPAR regulatory proteins (TARPs), chornichon homologs or the GSG1-l protein. However, comprehensive MS-based proteomics revealed that AMPARs are more complex supramolecular constructs which assemble from a pool of 34 proteins known to date. From these 34 proteins, 21 were newly identified via MS, un- derlining the strength of unbiased and hypothesis-free MS-based proteomics.Such MS-based approaches provide roadmaps for further in-depth and structural investigations of the molecular 25 Chapter 1. Introduction framework for the highly complex cell physiology of not only AMPARs, but also other ion chan- nels. Surprisingly, human TRP channel PPIs listed in table 6.1 were either determined via fusion protein-pull down assays with subsequent western blotting or classical Y2H assays. Only for two human TRP channels, namely TRPM4 and TRPV4, MS-based human protein interactome studies are published to date, both conducted in HEK293T cells. For human TRPM4, Caceres et al. identified proteins with actin cytoskeleton-related functions as the largest group of putative TRPM4 interactors, whereat McCray et al. identified a more diverse range of protein as putative TRPV4 interactors, with the small GTPase RhoA as one of the most significant ones (see also section 4.4 for a more detailed description of this PPI).68,69 Both approaches were performed with transiently transfected HEK293T cells, expressing the respective full-length channel fused with an affinity tag. This affinity tag enables the purification of the tagged (bait) protein from a cell extract via affinity enrichment, co-purifying putative interactors which are then identified by mass spectrometry.64 While this approach provides information about the putative interac- tome of the full-length channels, it is not possible to determine the exact interaction sites of the putative interactors within the channel. The other known (mostly rodent) TRPV4 interactors were mainly determined with non MS-based approaches like Y2H or co-immunoprecipitations (co-IPs) and can be mainly divided into three categories (for a list extracted from the TRIP database see table 6.2). First category compromises cytoskeletal and cytoskeletal associ- ated proteins like α-arrestin 1-2, tubulins, α-actin and PACSIN1-3, indicating TRPV4s role in mechanosensitivity.70,71 The second category includes interactors which modify TRPV4 post- translationally, like the tyrosin-kinases LYN and FYN or the E3 ubiquitin ligase ITCH. The third category includes transmembrane proteins like other TRP channels or AQP-4, for example. Most of the co-IPs were combined with site-directed mutagenesis to identify the exact TRPV4 interaction site, like for one of the most prominent TRPV4 interactors PACSIN3.70,71 Whereat approaches like before mentioned co-IPs with site directed mutagenesis of probable interac- tion sites are able to provide information about direct PPIs, the restriction to binary PPI studies compromises the speed but also an comprehensive overview of putative supramolecular com- plexes. Overall, little is known about the TRPV4 protein interactome. To get a comprehensive, unbiased overview of a complex proteome or interactome, the highly sophisticated ultra high- definition mass spectrometryE (UDMSE) - first presented by Distler et al. - is the method of choice.72 Shortly described, UDMSE increases drastically the number of identified peptides in a complex mixture by introducing collision-energy dependent traveling wave-based ion-mobility separation (CE-dependent IMS) into liquid-chromatography coupled mass spectrometry (LC- 26 Chapter 1. Introduction MS). With this, the precursor ion fragmentation efficiency improves significantly, enhancing the analytical depth of unbiased data-independent data acquisition.72 With this and by additionally developing a robust and comprehensive in-house software for UDMSE data analysis ,named ISOQuant, Distler and Kuharev et al. increased the numbers of identifiable protein groups com- pared to other generic MS set-ups significantly.73,74 With this, UDMSE is an excellent label-free and quantitative method to elucidate the protein interactome of TRPV4, which is involved in several severe channelopathies, as mentioned above. Due to the accumulation of disease- causing mutations in the cytosolic TRPV4 N-terminus (hsV4N), this domain was chosen as a starting point to elucidate the TRPV4 protein interactome in HEK293 cells. The high sensitivity and in-depth protein coverage of UDMSE is essential for future TRPV4 interactome investiga- tions in TRPV4 channelopathy-affected tissues, as this method is particularly suitable to identify altered tissue-specific protein-protein interactions as a possible reason for the disease pathol- ogy and tissue specificity of respective TRPV4 mutations.27 Therefore, UDMSE results serve as an excellent guidance for further in-depth investigations of determined TRPV4 interactome members. 1.4 Aim of this thesis - taming the wild child TRPV4 The TRPV4 N-terminus is a notorious hot-spot of disease-causing mutations, which mostly result in gain-of-function ion channels and dysregulated Ca2+-influx.49,53,54 Interestingly, es- pecially the N-terminus harbors a significant amount of mutation sites which cause peripheral neuropathies like Charcot-Marie-Tooth Type 2C (CMT2C).54,56,75 As the TRPV4 N-terminus con- sists of important protein interaction sites like the ankyrin repeat domain (ARD) or the proline rich region (PRR) and due to its cytosolic protrusion, this thesis elucidates the PPIs of the human (mutated) TRPV4 N-terminus (hsV4N) with a multipronged approach in vitro and in cellulo. For this, a major focus of this thesis was to elucidate the overall HEK293 cell pro- tein interactome of hsV4N via ultra high-definition mass spectrometryE (UDMSE) and to narrow down the interaction sites by conducting identical UDMSE experiments with the isolated TRPV4 ARD (hsV4 ARD). After data evaluation and protein-protein network analysis via gene ontol- ogy enrichment (GO), for example, promising interaction candidates were worked out. Possible direct interactions between hsV4N and respective candidates were then investigated with a versatile spectrum of methods, spanning from in cellulo experiments like live Ca2+-imaging, co- immunoprecipitations and fluorescence microscopy to the very detailed elucidation of PPIs with 27 Chapter 1. Introduction nuclear magnetic resonance spectroscopy and cross-linking mass spectrometry. Ultimately, this thesis laid the foundation to understand the tissue specific disease outcomes of TRPV4 muta- tions and for possible future regulations of the pathological Ca2+-influx, which is especially interesting for the progressive motoneuron-degeneration in CMT2C. 28 Chapter 2. Materials 2 Materials 2.1 Chemicals Table 2.1: Chemicals Chemical Supplier Acetic acid 100 % (AcOH) Roth, Karlsruhe Acrylamide/Bisacrylamide 37.5 % Roth, Karlsruhe Acetonitrile LC-MS grade (ACN) Roth, Karlsruhe 15N-Ammonium chloride (15NH4Cl) CIL Inc., Tewksbury (USA) Ammonium peroxisulfate (APS) Roth, Karlsruhe Adenosinediphosphate (ADP) Roth, Karlsruhe Adenosinetriphosphate (ATP) Roth, Karlsruhe Agar Agar Roth, Karlsruhe Agarose Roth, Karlsruhe Ampicillin sodium salt (Amp) Roth, Karlsruhe L-Ascorbic Acid Sigma-Aldrich, Munich D-Biotin Roth, Karlsruhe Dynabeads™M-280 Streptavidin Invitrogen, Darmstadt Dynabeads™Protein G Invitrogen, Darmstadt Bovine serum albumin (BSA) Roth, Karlsruhe Benzamidine hydrochlorid Sigma-Aldrich, Munich Bromphenol blue sodium salt Roth, Karlsruhe 3-[(3-Cholamidopropyl)dimethylammonio]- Roth, Karlsruhe 1-propanesulfonate (CHAPS) Coomassie Brilliant Blue G-250 Dye Roth, Karlsruhe Coomassie Brilliant Blue R-250 Dye Roth, Karlsruhe 29 Chapter 2. Materials Chemical Supplier Calcium chloride (CaCl2) Roth, Karlsruhe CHS (Cholesteryl hemisuccinate) Sigma Aldrich, Munich Digitonin Roth, Karlsruhe Dithiothreitol (DTT) Sigma-Aldrich, Munich Dimethylsulfoxide (DMSO), Headspace Grade or BioScience-Grade Roth, Karlsruhe 4’,6-diamidino-2-phenylindole (DAPI) Sigma-Aldrich, Munich Ethanol 99.9 % p.a. (EtOH) Roth, Karlsruhe Ethidium bromide 99.9 % AppliChem, Darmstadt Formic acid Optima LC/MS (FA) Thermo Scientific, Waltham (USA) Fura 2-AM Invitrogen, Darmstadt Glycerol Roth, Karlsruhe D-Glucose Roth, Karlsruhe GSK-1016790A (GSK-101, TRPV4 agonist) Sigma-Aldrich, Munich HC-067047 (HC-067, TRPV4 antagonist) Sigma-Aldrich, Munich 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid (HEPES) Sigma-Aldrich, Munich Hydrochloric acid (HCl) Roth, Karlsruhe Isopropyl-β-D-thiogalactopyranoside (IPTG) Roth, Karlsruhe Isopropyl alcohol Roth, Karlsruhe Imidazol Roth, Karlsruhe Kanamycin sulphate Roth, Karlsruhe Lipofectamin LTX Invitrogen, Darmstadt Methanol 99.9 % p.a. (MeOH) Roth, Karlsruhe Magnesium chloride hexahydrate (MgCl2·6 H2O) Roth, Karlsruhe Magnesium sulfate heptahydrate (MgSO4·7 H2O) Roth, Karslruhe Mowiol® 4-88 Sigma-Aldrich, Munich n-Dodecyl β-D-maltoside (DDM) Sigma-Aldrich, Munich β-nicotinamide adenine dinucleotide (NADH) Sigma-Aldrich, Munich Nickel nitrilotriacetic acid (Ni2+-NTA) agarose QIAGEN, Hilden Paraformaldehyde (PFA) Sigma-Aldrich, Munich Pierce™Lysis Buffer Invitrogen, Darmstadt CST Protease/Phosphatase Inhibitor Cocktail (100X) CST, Danvers (USA) 30 Chapter 2. Materials Chemical Supplier Precision Plus Protein™ Dual Color Standards BioRad, Hercules (USA) Phalloidin-TRITC Sigma-Aldrich, Munich Potassium ethylenediaminetetraacetic acid (K-EDTA) Roth, Karlsruhe Potassium hydroxide (KOH) Roth, Karslruhe Phenylmethylsulfonylfluoride (PMSF) Sigma-Aldrich, Munich Phosphoenolpyruvate (PEP) Sigma-Aldrich, Munich Potassium chloride (KCl) Roth, Karlsruhe PIPES (piperazine-N,N’-bis(2-ethanesulfonic acid)) Roth, Karlsruhe Roti®-Lumin 1 and 2 Roth, Karlsruhe SIGMAFAST Protease Inhibitor Cocktail Tablet, EDTA-Free Sigma-Aldrich, Munich Sodium chloride (NaCl) Roth, Karlsruhe Sodiumdodecylsulfate (SDS) Roth, Karlsruhe Sodium hydroxide (NaOH) Roth, Karlsruhe Sucrose Roth, Karlsruhe Tetramethylethylendiamine (TEMED) Roth, Karlsruhe Tris(hydroxymethyl)aminomethane (Tris) Roth, Karlsruhe Triton X-100 Roth, Karlsruhe Tween® 20 Roth, Karlsruhe Water, HPLC gradient grade Roth, Karlsruhe Water, LC-MS grade Roth, Karlsruhe 2.2 Buffer and solutions Table 2.2: General buffer and solutions Buffer/solution Ingredients 10x Running buffer pH = 8.3 20 mM Tris 1.54 M Glycin 31 Chapter 2. Materials Buffer/solution Ingredients 1x SDS-PAGE-Running buffer pH = 8.3 1x Running buffer 0.1 % (v/v) SDS 1x SDS-PAGE Wet blot buffer 1x Running buffer 20 % (v/v) EtOH 4x SDS-PAGE sample buffer 200 mM Tris/HCl pH = 6.8 400 mM DTT 8 % (v/v) SDS 0.4 % (w/v) Bromphenole blue 40 % (v/v) Glycerol 10x PBS pH = 7.4 2.7 mM KCl 10 mM Na2HPO4 2 mM KH2PO4 137 mM NaCl 1x PBS/T pH = 7.4 1x PBS 0.05 % (v/v) Tween® 20 2x HEPES pH = 7.5 12 mM Glucose 50 mM HEPES 10 mM KCl 280 mM NaCl 1.5 mM Na2HPO4· 2 H2O Coomassie staining solution 1 % (w/v) Coomassie blue R250 40 % (v/v) MeOH 10 % (v/v) Acetic acid Coomassie destaining solution 10 % (v/v) Acetic acid LB-Medium 25 g/L LB-Medium (Luria/Miller Broth) in MP-H2O TB-Medium 47.5 g/L TB-Medium (Terrific Broth) in MP-H2O Stripping buffer 100 mM NaOH 2 % (w/v) SDS 0.5 % (w/v) DTT Mobile Phase A 0.1 % (v/v) FA 3 % DMSO Ultrapure Water 32 Chapter 2. Materials Buffer/solution Ingredients Mobile Phase B 300 mM NaCl Ultrapure Water M9 Medium 15 g/L KH2PO4 33.9 g/L Na2HPO4 0.75 g/L 15NH4Cl 2.5 g/L NaCl 4 g/L Glucose 2 mM MgSO4 10 µM FeCl3 Trace elements 10 mL/L Magic Mix 1 mL/L Trace Elements 0.2 mg/mL CaCl2·2H2O 0.2 mg/mL ZnSO4·7H2O 0.2 mg/mL MnSO4·H2O 5 mg/mL Thiamine 5 mg/mL Niacin 0.1 mg/mL Biotin Magic Mix 1 Centrum Vitamin Tablet in 20 mL H2O Artifical CSF (aCSF) buffer 8.185 g/L NaCl 0.360 g/L KCl 0.203 g/L MgCl2·6H2O 0.294 g/L CaCl2·2H2O 4.320 g/L D-Glucose 2.350 g/L HEPES pH = 7.4 Hypotonic Artifical CSF (aCSF) buffer 0.360 g/L KCl 0.203 g/L MgCl2·6H2O 0.294 g/L CaCl2·2H2O 4.320 g/L D-Glucose 2.350 g/L HEPES pH = 7.4 Pulldown lysis buffer 412.0 g/L Sucrose 12.0 g/L PIPES pH = 6.8 23.2 g/L NaCl 33 Chapter 2. Materials Buffer/solution Ingredients 2.6 g/L MgCl2·6 H2O 187.5 mg/L Digitonin Electrophoresis cathode buffer pH = 8.3 25 mM Tris 192 mM Glycine 0.02 % Coomassie-G250 Table 2.3: Buffer and solutions for purification of hsV4N, hsV4N∆122 and hsV4N∆132 con- structs. hsV4N∆132 is also referred to as hsV4 ARD, hsV4N∆122 as hsV4 ARD-PRR. Buffer/solution Ingredients E.coli lysis buffer hsV4N and hsV4N∆132 20 mM Imidazol pH = 8 300 mM NaCl 20 mM Tris-HCl pH = 8 0.1 % (v/v) Triton X-100 add fresh: 1 mM Benzamidine 1 mM PMSF 1 SIGMAFAST Protease Inhibitor RNAse, DNAse, Lysozyme Wash 1 20 mM Imidazol pH = 8 300 mM NaCl 20 mM Tris-HCl pH = 8 Wash 2 50 mM Imidazol pH = 8 300 mM NaCl 20 mM Tris-HCl pH = 8 Elution 500 mM Imidazol pH = 8 300 mM NaCl 20 mM Tris-HCl pH = 8 SEC buffer 10 mM Tris-HCl pH = 7 1 mM K-EDTA pH = 7 34 Chapter 2. Materials Buffer/solution Ingredients 300 mM NaCl 1 mM DTT 1 mM Benzamidine Table 2.4: Buffer and solutions for purification of hsRhoA Buffer/solution Ingredients E.coli lysis buffer RhoA 200 mM NaCl 50 mM HEPES pH = 7.5 0.1 % (v/v) Triton X-100 10 % (v/v) Glycerol add fresh: 1 mM Benzamidine 1 mM PMSF 1 SIGMAFAST Protease Inhibitor RNAse, DNAse, Lysozyme IMAC Wash 1 50 mM Imidazol pH = 7.5 200 mM NaCl 50 mM HEPES pH = 7.5 5 % (v/v) Glycerol IMAC Elution 500 mM Imidazol pH = 7.5 200 mM NaCl 50 mM HEPES pH = 7.5 10 % (v/v) Glycerol TEV dialysis buffer 200 mM NaCl 25 mM Tris-HCl pH = 7 1 mM DTT 0.5 mM K-EDTA TEV: RhoA 1 to 30 molar ratio Reverse IMAC buffer 10 mM Imidazol pH = 7.5 35 Chapter 2. Materials Buffer/solution Ingredients 200 mM NaCl 50 mM HEPES pH = 7.5 SEC buffer 200 mM NaCl 50 mM HEPES pH = 7.5 5 mM MgCl2 Table 2.5: Buffer and solutions for purification of hsDDX3X_aa122-582 (DDX3X) Buffer/solution Ingredients E.coli lysis buffer hsDDX3X 10 mM Imidazol pH = 7.4 400 mM NaCl 50 mM NaH2PO4 pH = 7.4 0.1 % (v/v) Triton X-100 add fresh: 1 mM Benzamidine 1 mM PMSF 1 SIGMAFAST Protease Inhibitor RNAse, DNAse, Lysozyme IMAC Wash A buffer 10 mM Imidazol pH = 7.4 400 mM NaCl 50 mM NaH2PO4 pH = 7.4 IMAC Wash B buffer 20 mM Imidazol pH = 7.4 400 mM NaCl 50 mM NaH2PO4 pH = 7.4 IMAC High Salt buffer 1 M NaCl 50 mM NaH2PO4 pH = 7.4 IMAC Elution buffer 300 mM Imidazol pH = 7.4 150 mM NaCl 50 mM NaH2PO4 pH = 7.4 TEV dialysis buffer 300 mM NaCl 36 Chapter 2. Materials Buffer/solution Ingredients 25 mM NaH2PO4 pH = 7 1 mM DTT TEV: DDX3X 1 : 30 molar ratio Reverse IMAC buffer 10 mM Imidazol pH = 7.4 300 mM NaCl 25 mM NaH2PO4 pH = 7.4 SEC buffer 125 mM NaCl 25 mM HEPES pH = 7.4 Table 2.6: Buffer and solutions for purification of hsITCH Buffer/solution Ingredients E.coli lysis buffer hsITCH 200 mM NaCl 50 mM Tris-HCl pH = 8 0.1 % (v/v) Triton X-100 5 % (v/v) Glycerol 0.1 % (v/v) DDM add fresh: 1 mM Benzamidine 1 mM PMSF 1 SIGMAFAST Protease Inhibitor RNAse, DNAse, Lysozyme IMAC Wash 1 25 mM Imidazol pH = 8 200 mM NaCl 50 mM Tris-HCl pH = 8 5 % (v/v) Glycerol IMAC Elution 500 mM Imidazol pH = 8 200 mM NaCl 50 mM Tris-HCl pH = 8 5 % (v/v) Glycerol 37 Chapter 2. Materials Buffer/solution Ingredients TEV dialysis buffer 200 mM NaCl 50 mM Tris-HCl pH = 8 1 mM DTT TEV: ITCH 1 : 30 molar ratio Reverse IMAC buffer 10 mM Imidazol pH = 8 200 mM NaCl 50 mM Tris-HCl pH = 8 5 % (v/v) Glycerol SEC buffer 200 mM NaCl 50 mM Tris-HCl pH = 8 1.5 % (v/v) Glycerol Table 2.7: Buffer and solutions for purification of hsITCH WW domain constructs Buffer/solution Ingredients E.coli lysis buffer hsITCH WW domains 200 mM NaCl 50 mM Tris-HCl pH = 8 0.1 % (v/v) Triton X-100 5 % (v/v) Glycerol add fresh: 1 mM Benzamidine 1 mM PMSF 1 SIGMAFAST Protease Inhibitor RNAse, DNAse, Lysozyme IMAC Wash 1 25 mM Imidazol pH = 8 200 mM NaCl 50 mM Tris-HCl pH = 8 5 % (v/v) Glycerol IMAC Elution 500 mM Imidazol pH = 8 200 mM NaCl 38 Chapter 2. Materials Buffer/solution Ingredients 50 mM Tris-HCl pH = 8 5 % (v/v) Glycerol TEV dialysis buffer 200 mM NaCl 50 mM Tris-HCl pH = 8 1 mM DTT TEV: ITCH 1 : 30 molar ratio Reverse IMAC 10 mM Imidazol pH = 8 200 mM NaCl 50 mM Tris-HCl pH = 8 5 % (v/v) Glycerol SEC buffer 200 mM NaCl 50 mM Tris-HCl pH = 8 Table 2.8: Buffer and solutions for purification of TRPC 3, 4 and 6 ARDs Buffer/solution Ingredients E.coli lysis buffer TRPC ARDs 20 mM Imidazol pH = 8 300 mM NaCl 20 mM Tris-HCl pH = 8 0.1 % (v/v) Triton X-100 add fresh: 1 mM Benzamidine 1 mM PMSF 1 SIGMAFAST Protease Inhibitor RNAse, DNAse, Lysozyme IMAC Wash 1 20 mM Imidazol pH = 8 300 mM NaCl 20 mM Tris-HCl pH = 8 Wash 2 50 mM Imidazol pH = 8 300 mM NaCl 39 Chapter 2. Materials Buffer/solution Ingredients 20 mM Tris-HCl pH = 8 Elution 500 mM Imidazol pH = 8 300 mM NaCl 20 mM Tris-HCl pH = 8 SEC buffer 10 mM Tris-HCl pH = 7 1 mM K-EDTA pH = 7 300 mM NaCl 1 mM DTT 1 mM Benzamidine Table 2.9: Buffer and solutions for purification of hsYAP-WW domains Buffer/solution Ingredients E.coli lysis buffer hsYAP WW domains 20 mM Imidazol pH = 7.4 120 mM NaCl 30 mM HEPES pH = 7.4 0.1 % (v/v) Triton X-100 add fresh: 1 mM Benzamidine 1 mM PMSF 1 SIGMAFAST Protease Inhibitor RNAse, DNAse, Lysozyme IMAC Wash 1 20 mM Imidazol pH = 8 120 mM NaCl 30 mM HEPES pH = 8 IMAC Wash 2 50 mM Imidazol pH = 8 120 mM NaCl 30 mM HEPES pH = 8 IMAC Wash 3 75 mM Imidazol pH = 8 120 mM NaCl 40 Chapter 2. Materials Buffer/solution Ingredients 30 mM HEPES pH = 8 IMAC Elution 500 mM Imidazol pH = 8 120 mM NaCl 30 mM HEPES pH = 8 TEV dialysis buffer 300 mM NaCl 25 mM Tris-HCl pH = 7 1 mM DTT TEV: hsYAP-WW domains 1 : 30 molar ratio Reverse IMAC buffer 10 mM Imidazol pH = 8 120 mM NaCl 30 mM HEPES pH = 8 SEC buffer 120 mM NaCl 30 mM HEPES pH = 7.4 2.3 Enzymes Table 2.10: Enzymes Enzymes Supplier Desoxyribonuclease I (DNAse) Sigma-Aldrich, Munich DpnI NewEngland BioLabs, Frankfurt a.M. HiFi Polymerase Kapa Biosystems, Wilmington (USA) Lactate Dehydrogenase (LDH) Sigma-Aldrich, Munich Lysozyme Sigma-Aldrich, Munich Ribonuclease A (RNAse) Sigma-Aldrich, Munich T5 Exonuclease NewEngland BioLabs, Frankfurt a.M. Phusion DNA Polymerase NewEngland BioLabs, Frankfurt a.M. Pyruvate Kinase (PK) Sigma-Aldrich, Munich Taq DNA Ligase NewEngland BioLabs, Frankfurt a.M. 41 Chapter 2. Materials Enzymes Supplier E1 Ubiquitin ligase UBE1 Prof. Sumner, Baltimore (USA) E2 Ubiquitin ligase Ubc5Hc Prof. Sumner, Baltimore (USA) 2.4 Antibodies Table 2.11: Antibodies Antibody Supplier Anti-ANXA2 mouse Sigma-Aldrich, Munich Anti-DDX3X rabbit Sigma Aldrich, Munich Anti-GFP mouse (3E6) Invitrogen, Darmstadt Anti-GFP mouse Sigma-Aldrich, Munich Anti-FLAG mouse CST, Danvers (USA) Anti-FLAG rabbit CST, Danvers (USA) Anti-V5 mouse CST, Danvers (USA) Anti-myc mouse CST, Danvers (USA) Anti-His6-HRP Invitrogen, Darmstadt Streptavidin-POD (Strep-POD) Roche, Basel (CH) Horse anti-mouse HRP-linked IgG CST, Danvers (USA) Goat anti-rabbit HRP-linked IgG CST, Danvers (USA) Alexa-Fluor-488 goat anti-mouse Invitrogen, Darmstadt Alexa-Fluor-555 goat anti-rabbit Invitrogen, Darmstadt Alexa Fluor-647 goat anti-mouse Invitrogen, Darmstadt Alexa Fluor-647 goat anti-rabbit Invitrogen, Darmstadt 42 Chapter 2. Materials 2.5 Oligonucleotides The oligonucleotides in tables 2.12 and 2.13 were designed in the course of this work and were obtained from Sigma-Aldrich (Munich). For the estimation of the melting temperatures equation 2.1 was used. The nomenclature of the primers refers to the employed nomenclature at the Hellmich workgroup. Tm = 4 · #G and C + 2 · #A and T (2.1) Table 2.12: Oligonucleotides for Quickchange PCR ′ ′ Designation Sequence (5 –3 ) Length Tm [°C] human TRPV4 S134A_for GAGAAGCAGCCGCAGGAACCCAAAGCC 27mer 71 human TRPV4 S134A_rev GTCGGCGTCCTTGGGTTTCGGGGAC 25mer 70 human TRPV4 S134E_for GAGAAGCAGCCGCAGGAACCCAAAGAA 27mer 67 human TRPV4 S134E_rev GTCGAAGTCCTTGGGTTTCGGGGAC 25mer 65 human TRPV4 E183K_for CGCCTAACTGATAAGGAGTTTCGAG 25mer 70 human TRPV4 E183K_rev GGCTCTCGAAACTCCTTATCAGTTAG 26mer 70 human TRPV4 L199F_for GCCCAAGGCCTTTCTGAACCTGAGC 25mer 75 human TRPV4 L199F_rev CATTGCTCAGGTTCAGAAAGGCCTTG 26mer 71 human TRPV4 R232C_for CATTAACTCGCCCTTCTGTGACATC 25mer 70 human TRPV4 R232C_rev GATAGTAGATGTCACAGAAGGGCGAG 26mer 72 human TRPV4 R269C_for GCCCAGGCCTGTGGGCGCTTCTTC 24mer 78 human TRPV4 R269C_rev GCTGGAAGAAGCGCCCACAGGCCTG 25mer 78 human TRPV4 R271P_rev CCCGTGGGCCCTTCTTCCAGCC 22mer 75 human TRPV4 R271P_rev CTTGGGCTGGAAGAAGGGCCCACG 24mer 76 human TRPV4 K276E_for CGCTTCTTCCAGCCCGAGGATGAG 24mer 75 human TRPV4 K276E_rev CCCCCTCATCCTCGGGCTGGAAG 23mer 76 human TRPV4 R315W_for GGCGGACATGTGGCGCCAGGACTC 24mer 78 human TRPV4 R315W_rev CGCGAGTCCTGGCGCCACATGTC 23mer 77 human TRPV4 R316C_for GACATGCGGTGCCAGGACTCGCG 23mer 77 human TRPV4 R316C_rev GCCTCGCGAGTCCTGGCACCGC 22mer 77 43 Chapter 2. Materials Table 2.12: Oligonucleotides for Quickchange PCR ′ ′ Designation Sequence (5 –3 ) Length Tm [°C] human TRPV4 I331F_for CTGGTGGCCTTTGCTGACAACACC 24mer 73 human TRPV4 I331F_rev GTTGTCAGCAAAGGCCACCAGCGCATG 27mer 77 human TRPV4 D333G_for CTGGTGGCCATTGCTGGCAACACCCGTG 28mer 80 human TRPV4 D333G_rev GTTCTCACGGGTGTTGCCAGCAATGGCCAC 30mer 81 human TRPV4 V342F_for CGTGAGAACACCAAGTTTTTTACCAAGATG 30mer 72 human TRPV4 V342F_rev GGTCGTACATCTTGGTAAAAAACTTGGTG 29mer 72 human TRPV4 M680K_for CTGACCATCGGCAAGGGCGAC 21mer 72 human TRPV4 M680K_rev CGCCCTTGCCGATGGTCAGC 20mer 72 Table 2.13: Oligonucleotides for Gibbson Assembly ′ ′ Designation Sequence (5 –3 ) Length Tm [°C] pCAGIG_PACSIN1_V_for CTCAGATGGTTCCGCAGCACCAGTGGCCC 36mer 64 CGGCATG pCAGIG_PACSIN1_V_rev CGTCCGTGGTACAGGTCGAGGATGCTACT 39mer 63 CCGGAGTGAC pCAGIG_P1V_P3F_for CGATGAGGCCTCACTGATGGCTCCAGAA 38mer 62 GAGGACGCTG pCAGIG_P1V_P3F_rev GCTGCGGAACCATCTGAGATCCTCT 42mer 63 TCGTCACTGGCTGCCTC pCAGIG_P1V_P2F_for CGATGAGGCCTCACTGGTAGAAGTGTC 40mer 63 CAGCGACAGCTTCTG pCAGIG_P1V_P2F_rev GCTGCGGAACCATCTGAGGTCCTCCAC 39mer 64 TGCATCAGCTGCTCTG pCAGIG_PACSIN2_V_for CTGAGGTGGTTCCGAGCCAATCACGGG 36mer 65 CCGGGCATG pCAGIG_PACSIN2_V_rev TCCAACGGAATCATCATATGTGACAGA 46mer 61 CATGGTGCCTGCTTTTTTG 44 Chapter 2. Materials Table 2.13: Oligonucleotides for Gibbson Assembly 5′ 3′Designation Sequence ( – ) Length Tm [°C] pCAGIG_P2V_P1F_for CATATGATGATTCCGTTGGAGCGCCAGA 41mer 65 GGAGACCACCGAC pCAGIG_P2V_P1F_rev CTCGGAACCACCTCAGGTCTTCCTGGGC 37mer 64 pCAGIG_P2V_P3F_for CATATGATGATTCCGTTGGAATGGCTCC 43mer 64 AGAAGAGGACGCTGG pCAGIG_P2V_P3F_rev CTCGGAACCACCTCAGATCCTCTTCGTC 40mer 63 ACTGGCTGCCTC pCAGIG_PACSIN3_V_for CTGCGCTGGTGGCGCAGCACCCACGGGCC 32mer 64 AGG pCAGIG_PACSIN3_V_rev GGTGGAGCCTGCTTTTTTGTACAAACTTG 48mer 62 TGATCAATTCGGTGCTGTC pCAGIG_P3V_P1F_for AAAAAAGCAGGCTCCACCGCGCCAGAGGA 39mer 65 GACCACCGAC pCAGIG_P3V_P1F_rev GCGCCACCAGCGCAGGTCTTCCTGGGCAT 37mer 64 CAGCCCCC pCAGIG_P3V_P2F_for AAAAAGCAGGCTCCACCGTAGAAGTGTCC 39mer 64 AGCGACAGCTTCTGG pCAGIG_P3V_P2F_rev GCGCCACCAGCGCAGGTCCTCCACTGCAT 40mer 63 CAGCTGCTCTG Table 2.14: Sequencing oligonucleotides ′ ′ Designation Sequence (5 –3 ) Length T7_promotor TAATACGACTCACTATAGGG 20mer T7_terminator GCTAGTTATTGCTCAGCGG 19mer SP6 ATTAGGTGACACTATAG 18mer 45 Chapter 2. Materials 2.6 Plasmids and expression constructs T7_oligonucloetides (table 2.14 ) were used to determine the DNA sequence of the various modified pET21, pET28a, pET11 and pcDNA3.1 plasmids (table 2.14). For reverse sequencing of pcDNA3.1 the SP6 oligonucleotide was used. mm = Mus musculus (mouse), hs = Homo sapiens (human), gg = Gallus gallus (chicken), rn = Rattus norvegicus (rat), d = Drosophila melanogaster (fruit fly), dr = Danio rerio (zebra fish). 46 Chapter 2. Materials 47 Table 2.15: Expression plasmids generated and used in the course of this work. hsV4N∆132 is also referred as hsV4 ARD, hsV4N∆122 as hsV4 ARD-PRR. The nomenclature of the plasmids refers to the employed nomenclature at the Hellmich workgroup. Plasmid Construct Vector Resistance Origin p17 eGFP pcDNA3.1 Ampicillin RG Mainz p22 rnTRPV2-cGFP pcDNA3.1-cGFP Ampicillin Prof. , Cambridge p24 ggTRPV4-cGFP pcDNA3.1-cGFP Ampicillin Prof. Cambridge p25 dTRPML-cGFP pcDNA3.1-cGFP Ampicillin Prof. , Cambridge p34 rnTRPV1-ARD pET21-cHis6 Ampicillin Prof. Cambridge p35 drTRPV1-ARD pET21-cHis6 Ampicillin Prof. Cambridge p36 ggTRPV1-ARD pET21-cHis6 Ampicillin Prof. Cambridge p37 rnTRPV2-ARD pET21-cHis6 Ampicillin Prof. , Cambridge p41 hsCalmodulin pET21-cHis6 Ampicillin Prof. Cambridge p62 Ulp-1 pET28a Kanamycin Prof. , Frankfurt a.M. p113 hsTRPML-1-nGFP pEGFP C3 Kanamycin Prof. , Cambridge p114 mmTRPML-2b-c pcDNA3.1-cYFP Ampicillin Prof. , Santa Barbara p129 ggV4N-cGFP pcDNA3.1-cGFP Ampicillin 21, Mainz p130 ggV4N_aawaa-cGFP pcDNA3.1-cGFP Ampicillin i21, Mainz p131 ggV4N∆53-cGFP pcDNA3.1-cGFP Ampicillin i21, Mainz p132 ggV4N∆53_aawaa-cGFP pcDNA3.1-cGFP Ampicillin i21, Mainz p134 hsV4N pET21-cHis6 Ampicillin Prof. , Cambridge (USA) p138 BirA ligase pET21-cHis6 Ampicillin RG Mainz p151 hsV4N Avi2 pET21-cHis6 Ampicillin B. Sc. E. Diehl, Mainz76 p154 hsV4N Avi3 pET21-cHis6 Ampicillin B. Sc. E. Diehl, Mainz76 p155 BirA ligase pET28a Kanamycin B. Sc. E. Diehl , Mainz76 Chapter 2. Materials 48 Table 2.15: Expression plasmids generated and used in the course of this work. hsV4N∆132 is also referred as hsV4 ARD, hsV4N∆122 as hsV4 ARD-PRR. The nomenclature of the plasmids refers to the employed nomenclature at the Hellmich workgroup. Plasmid Construct Vector Resistance Origin p181 ggV4N∆122-cGFP pcDNA3.1-cGFP Ampicillin M. Sc. , Mainz p182 ggV4N∆132-cGFP pcDNA3.1-cGFP Ampicillin M. Sc. , Mainz p222 hsV4N∆132 pET21-cHis6 Ampicillin M. Sc. E. Diehl, Mainz76 p223 hsV4N∆122 pET21-cHis6 Ampicillin M. Sc. E. Diehl, Mainz76 p381 hsV4N∆132 E183K pET21-cHis6 Ampicillin and M. Sc. E. Diehl, Mainz77 p382 hsV4N∆132 L199F pET21-cHis6 Ampicillin itt and M. Sc. E. Diehl, Mainz77 p383 hsV4N∆132 R232C pET21-cHis6 Ampicillin and M. Sc. E. Diehl, Mainz77 p384 hsV4N∆132 R269C pET21-cHis6 Ampicillin and M. Sc. E. Diehl, Mainz77 p385 hsV4N∆132 R271P pET21-cHis6 Ampicillin and M. Sc. E. Diehl, Mainz77 p386 hsV4N∆132 K276E pET21-cHis6 Ampicillin and M. Sc. E. Diehl, Mainz77 p387 hsV4N∆132 R315W pET21-cHis6 Ampicillin and M. Sc. E. Diehl, Mainz77 p388 hsV4N∆132 R316C pET21-cHis6 Ampicillin and M. Sc. E. Diehl, Mainz77 p389 hsV4N∆132 V342F pET21-cHis6 Ampicillin and M. Sc. E. Diehl, Mainz77 p390 hsV4N∆132 Avi2 pET21-cHis6 Ampicillin and M. Sc. E. Diehl77, Mainz p793 hsV4N∆132 E183K Avi2 pET21-cHis6 Ampicillin and M. Sc. E. Diehl, Mainz77 p794 hsV4N∆132 L199F Avi2 pET21-cHis6 Ampicillin and M. Sc. E. Diehl, Mainz77 p795 hsV4N∆132 R232C Avi2 pET21-cHis6 Ampicillin and M. Sc. E. Diehl, Mainz77 p796 hsV4N∆132 R269C Avi2 pET21-cHis6 Ampicillin and M. Sc. E. Diehl, Mainz77 p797 hsV4N∆132 R271P Avi2 pET21-cHis6 Ampicillin and M. Sc. E. Diehl, Mainz77 p798 hsV4N∆132 K276E Avi2 pET21-cHis6 Ampicillin and M. Sc. E. Diehl, Mainz77 p799 hsV4N∆132 R315W Avi2 pET21-cHis6 Ampicillin and M. Sc. E. Diehl, Mainz77 Chapter 2. Materials 49 Table 2.15: Expression plasmids generated and used in the course of this work. hsV4N∆132 is also referred as hsV4 ARD, hsV4N∆122 as hsV4 ARD-PRR. The nomenclature of the plasmids refers to the employed nomenclature at the Hellmich workgroup. Plasmid Construct Vector Resistance Origin p800 hsV4N∆132 R316C Avi2 pET21-cHis6 Ampicillin and M. Sc. E. Diehl, Mainz77 p801 hsV4N∆132 V342F Avi2 pET21-cHis6 Ampicillin and M. Sc. E. Diehl, Mainz77 p412 hsYAP1_WW1 domain pET11a-nHis6 Ampicillin obtained from GeneScript, M. Sc. E. Diehl p413 hsYAP1_WW2 domain pET11a-nHis6 Ampicillin obtained from GeneScript, M. Sc. E. Diehl p414 hsYAP1_WW1+WW2 domains pET11a-nHis6 Ampicillin obtained from GeneScript, M. Sc. E. Diehl p505 hsITCH pET11a-nHis6 Ampicillin obtained from GeneScript, M. Sc. E. Diehl p506 hsITCH_WW1 domain pET11a-nHis6 Ampicillin obtained from GeneScript, M. Sc. E. Diehl p507 hsITCH_WW2 domain pET11a-nHis6 Ampicillin obtained from GeneScript, M. Sc. E. Diehl p508 hsITCH_WW3 domain pET11a-nHis6 Ampicillin obtained from GeneScript, M. Sc. E. Diehl p509 hsITCH_WW4 domain pET11a-nHis6 Ampicillin obtained from GeneScript, M. Sc. E. Diehl p510 hsITCH_WW1+WW2 domains pET11a-nHis6 Ampicillin obtained from GeneScript, M. Sc. E. Diehl p511 hsITCH_WW3+WW4 domains pET11a-nHis6 Ampicillin obtained from GeneScript, M. Sc. E. Diehl p512 hsRhoA pET11a-nHis6 Ampicillin obtained from GeneScript, M. Sc. E. Diehl p513 hsITCH_WW1−WW4 domains pET11a-nHis6 Ampicillin obtained from GeneScript, M. Sc. E. Diehl p598 BirA R118A-nP1 pcDNA3.1-cGFP Ampicillin and M. Sc. E. Diehl, Mainz78 p802 hsTRPV4 pcDNA3.1-cGFP Ampicillin Prof. Baltimore p803 hsTRPV4 S134E pcDNA3.1-cGFP Ampicillin and M. Sc. E. Diehl, Mainz78 p804 hsTRPV4 S134A pcDNA3.1-cGFP Ampicillin and M. Sc. E. Diehl, Mainz78 p805 hsTRPV4 R232C pcDNA3.1-cGFP Ampicillin this work p806 hsTRPV4 R269C pcDNA3.1-cGFP Ampicillin this work p807 hsTRPV4 R271P pcDNA3.1-cGFP Ampicillin this work Chapter 2. Materials 50 Table 2.15: Expression plasmids generated and used in the course of this work. hsV4N∆132 is also referred as hsV4 ARD, hsV4N∆122 as hsV4 ARD-PRR. The nomenclature of the plasmids refers to the employed nomenclature at the Hellmich workgroup. Plasmid Construct Vector Resistance Origin p808 hsTRPV4 K276E pcDNA3.1-cGFP Ampicillin this work p809 hsTRPV4 R315W pcDNA3.1-cGFP Ampicillin this work p810 hsTRPV4 V342F pcDNA3.1-cGFP Ampicillin this work p811 hsTRPV4 M680K pcDNA3.1-cGFP Ampicillin and M. Sc. E. Diehl, Mainz78 p812 hsTRPV4 pcDNA3.1-cFLAG Ampicillin Prof. Baltimore p813 hsTRPV4 R232C pcDNA3.1-cFLAG Ampicillin and M. Sc. E. Diehl, Mainz77 p814 hsTRPV4 R269C pcDNA3.1-cFLAG Ampicillin Prof. , Baltimore p815 hsV4N∆132 I331F pET21-cHis6 Ampicillin and M. Sc. E. Diehl, Mainz78 p816 hsV4N∆132 D333G pET21-cHis6 Ampicillin and M. Sc. E. Diehl, Mainz78 p817 hsDDX3X_aa122-582 pET21-nHis6 Kanamycin Prof. Regensburg p818 hsDDX3X pcDNA3.1-nV5 Ampicillin obtained from GeneScript, M. Sc. E. Diehl, Mainz p819 mmPACSIN1 pCAGIG-nV5 Ampicillin Prof. Baltimore p820 mmPACSIN2 pCAGIG-nV5 Ampicillin Prof. Baltimore p821 mmPACSIN3 pCAGIG-nV5 Ampicillin Prof. Baltimore p822 hsPACSIN1 pCAGIG-nV5 Ampicillin Prof. , Baltimore p823 hsPACSIN2 pCAGIG-nV5 Ampicillin Prof. , Baltimore p824 hsPACSIN3 pCAGIG-nV5 Ampicillin Prof. Baltimore p825 hsPACSIN_F1_S2 pCAGIG-nV5 Ampicillin this work (hsPACSIN2+1) Chapter 2. Materials 51 Table 2.15: Expression plasmids generated and used in the course of this work. hsV4N∆132 is also referred as hsV4 ARD, hsV4N∆122 as hsV4 ARD-PRR. The nomenclature of the plasmids refers to the employed nomenclature at the Hellmich workgroup. Plasmid Construct Vector Resistance Origin p826 hsPACSIN_F1_S3 pCAGIG-nV5 Ampicillin this work (hsPACSIN3+1) p827 hsPACSIN_F2_S1 pCAGIG-nV5 Ampicillin this work (hsPACSIN1+2) p828 hsPACSIN_F2_S3 pCAGIG-nV5 Ampicillin this work (hsPACSIN3+2) p829 hsPACSIN_F3_S1 pCAGIG-nV5 Ampicillin this work (hsPACSIN1+3) p830 hsPACSIN_F3_S2 pCAGIG-nV5 Ampicillin this work (hsPACSIN2+3) p831 mCherry pcDNA3.1 Ampicillin Prof. Baltimore p832 hsYAP1 pcDNA3.1-nV5 Ampicillin Prof. , Baltimore p833 hsRUVBL1 pcDNA3.1-nmyc Ampicillin Prof. Baltimore p834 Empty Vector (EV) pcDNA3.1 Ampicillin Prof. Baltimore p835 hsTRPC3 ARD_aa16-181 pET11a-nHis6 Ampicillin Prof. , Cambridge p836 hsTRPC4 ARD_aa25-185 pET11a-nHis6 Ampicillin Prof. Cambridge p837 hsTRPC6 ARD_aa87-252 pET11a-nHis6 Ampicillin Prof. , Cambridge Chapter 2. Materials 2.7 Peptide and protein characteristics In the following, protein and peptide characteristics of the constructs used in this work are listed. Table 2.16 lists all constructs which were recombinantly expressed in E. coli BL21 Gold (DE3) cells and subsequently purified according section 3.7. Characteristics of protein and peptides with no TEV-cleavage site are listed with the His6-tag, whereas TEV cleavage site containing proteins are listed without His6-tag. Table 2.17 lists all protein construct which were recombinantly expressed in HEK293 and/or HEK293T cells (see also sections3.2.1, 3.3, 3.4 and 3.5). Table 2.16: Physicochemical properties of proteins and peptides recombinantly expressed in E. coli BL21 Gold (DE3), purified and used in this thesis. Characteristics were calculated using the Protparam tool (http://web.expasy.org/protparam/). hsV4N∆132 is also referred to as hsV4 ARD, hsV4N∆122 as hsV4 ARD-PRR. MW: molecular weight [Da]; AA: number of amino acids; pI: isoelectric point;  280: extinction coefficient at 280 nm in [L mol−1 cm−1] Peptide/ protein MW [Da] AA pI  280 hsDDX3X_aa 122-582 52 057 461 5.61 44 725 BirA ligase 35 312 321 7.76 47 440 hsV4N-cHis6 44 977 406 8.24 20 650 hsV4N Avi2-cHis6 46 788 421 7.00 25 900 hsV4N∆122-cHis6 30 616 271 9.00 10 680 hsV4N∆132-cHis6 29 221 257 8.65 10 680 hsV4N∆132-cHis6 R232C 29 221 257 8.65 10 680 hsV4N∆132-cHis6 R269C 29 221 257 8.65 10 680 hsV4N∆132-cHis6 D333G 29 221 257 8.65 10 680 hsV4N∆132-Avi2 31 089 273 7.39 16 180 hsV4N∆132-Avi2 R232C 31 089 273 7.39 16 180 hsV4N∆132-Avi2 K276E 31 089 273 7.39 16 180 hsV4N∆132-Avi2 V342F 31 089 273 7.39 16 180 hsTRPC3 ARD_aa16-181-nHis6 19 887 175 5.49 10 555 hsTRPC4 ARD_aa25-185-nHis6 18 055 161 5.91 7450 hsTRPC6 ARD_aa87-252-nHis6 19 923 175 5.55 10 555 hsYAP1_WW1 domain 5184 45 4.89 12 490 52 Chapter 2. Materials Peptide/ protein MW [Da] AA pI  280 hsYAP1_WW2 domain 4589 40 4.89 13 980 hsYAP1_WW1+WW2 domains 11 926 105 4.88 26 470 hsITCH 102 859 904 5.94 154 085 hsITCH_WW1 domain 14 112 135 10.34 13 980 hsITCH_WW2 domain 4246 35 8.59 13 980 hsITCH_WW3 domain 3981 34 8.59 12 490 hsITCH_WW4 domain 4923 42 5.58 8480 hsITCH_WW1+WW2 domains 17 926 166 10.48 27 960 hsITCH_WW3+WW4 domains 8772 74 6.94 20 970 hsITCH_WW1-WW4 domains 32 219 286 9.59 57 410 hsRhoA 21 825 194 5.84 18 825 Table 2.17: Physicochemical properties of proteins and peptides recombinantly expressed in HEK293 and/or HEK293T cells in this thesis. Characteristics were calculated using the Prot- param tool (http://web.expasy.org/protparam/). MW: molecular weight [Da]; AA: number of amino acids Protein MW [Da] AA hsTRPV4-cGFP 125 204 1110 hsTRPV4 R232C-cGFP 125 204 1110 hsTRPV4-nFLAG 99 276 879 hsTRPV4 R269C-nFLAG 99 276 879 hsPACSIN-1-nV5 53 776 471 hsPACSIN-2-nV5 58 549 513 hsPACSIN-3-nV5 51 297 451 hsPACSIN-F1-S2-nV5 34 879 305 (hsPACSIN2+1-nV5) hsPACSIN-F1-S3-nV5 40 859 355 (hsPACSIN3+1-nV5) hsPACSIN-F2-S1-nV5 53 423 471 53 Chapter 2. Materials Protein MW [Da] AA (hsPACSIN1+2-nV5) hsPACSIN-F2-S3-nV5 50 823 444 (hsPACSIN3+2-nV5) hsPACSIN-F3-S1-nV5 54 155 479 (hsPACSIN1+3-nV5) hsPACSIN-F3-S2-nV5 36 478 318 (hsPACSIN3+2-nV5) hsDDX3X-nV5 76 154 690 hsRUVBL1-myc 51 757 470 mCherry 26 722 236 2.8 Kits Table 2.18: Kits Designation Usage Supplier E.Z.N.A Plasmid Mini Kit I Plasmid DNA isolation Omega Bio-Tek, Norcross (USA) GenepHlow Gel/PCR Kit PCR clean up Geneaid, New Tapei City (TW) GTPase Glo Assay Instrinsic GTPase acivity assay Promega, Walldorf KAPA HiFi HotStart PCR Kit PCR ingredients Kapa Biosystems, Wilmington (USA) Fluo-4 Direct Calcium Assay Ca2+-influx assay Invitrogen, Darmstadt 4 - 15 % Mini-Protean® TGX™ Blue native (BN) Precast Protein Gels PAGE gels BioRad, Hercules (USA) 54 Chapter 2. Materials 2.9 Media and supplements for cell culture Table 2.19: Media and supplements for cell culture Name Supplier LB-Medium (Luria Broth) Roth, Karlsruhe TB-Medium (Terrific Broth) Roth, Karlsruhe Dulbecco’s Modified Eagle Medium (DMEM) Invitrogen, Darmstadt Fetal calf serum (FCS) Invitrogen, Darmstadt 10x Trypsin Invitrogen, Darmstadt G-418 Sigma-Aldrich, Munich L-Glutamine Invitrogen, Darmstadt Penicillin / Streptomycin (P/S) Sigma-Aldrich, Munich Poly-L-lysine Invitrogen, Darmstadt 2.10 Cells Cells were obtained from various sources indicated in table 2.20. HEK293-hsV4-cGFP and HEK293-hsTRPML1-nGFP are stably transfected HEK293 cell strains which were obtained in the course of this work (see 3.2.3 for procedure). Table 2.20: Cells Name Source E. coli strain BL21 (DE3) Gold Agilent Technologies, Santa Clara (USA) E. coli strain DH5α Agilent Technologies, Santa Clara (USA) HEK293 cells PD , Mainz HEK293T cells Prof. , Mainz Prof. Baltimore (USA) HEK293-hsV4-cGFP this work 55 Chapter 2. Materials Table 2.20: Cells Name Source HEK293-hsTRPML1-nGFP this work 2.11 Laboratory equipment Table 2.21: Laboratory equipment Name Supplier Acquity UPLC HSS-T3 reverse phase column Waters Corporation, Milford (USA) Avanti J-26XP Centrifuge Beckmann Coulter, Brea (USA) Bruker AVANCE 600, 700 and 800 MHz spectrometers Bruker, Karlsruhe Branson Sonifier 250 Branson, Danbury (USA) Centrifuge 5810 R Eppendorf, Hamburg Centrifuge 5415 R Eppendorf, Hamburg Centrifuge rotor JA 25.50 Eppendorf, Hamburg Centrifuge rotor JLA 8.1000 Eppendorf, Hamburg Optima MAX XP Ultra-centrifuge Beckmann Coulter, Brea (USA) NGC-Quest ÄKTA purifier BioRad, Hercules (USA) FlexStation 3 MultiMode Plate Reader MolecularDevices, San Jose (USA) FLUOStar Omega Microplate Reader BMG LabTech, Ortenberg Frac-920 Fraction collector BioRad, Hercules (USA) INCU-line IL 10 Incubator VWR, Radnor (USA) J-815 CD Spectrometer JASCO, Pfungstadt Lamda DG-4 wavelength switcher Sutter Instruments, San Francisco (USA) pH electrode LE409 Mettler-Toledo, Columbus (USA) Photometer Lambda 25 Perkin Elmer , Waltham (USA) PowerPac Basic power supply BioRad, Hercules (USA) ViewPix700 Scanner GE Healthcare, Fairfield (USA) 56 Chapter 2. Materials Name Supplier Mini-PROTEAN Tetra Cell BioRad, Hercules (USA) HiLoad 16/600 Superdex 75 SEC column GE Healthcare, Fairfield (USA) HiLoad 16/600 Superdex 200 SEC column GE Healthcare, Fairfield (USA) Spectrofluorometric detector RF-20A Shimadzu, Kyoto (Japan) STELLA 3200 CCD camera Raytest GmbH, Straubenhardt Synapt G2-S HDMS Waters Corporation, Milford (USA) Thermomixer comfort Eppendorf, Hamburg nanoAcquity UPLC Waters Corporation, Milford (USA) NanoDrop 2000c UV-Vis spectrophotometer Thermo Scientific, Waltham (USA) Membrane pump MD 4C Vacuubrand, Wertheim Thermal cycler Primus 25 MWG Biotech, Ebersberg Quantum gel documentation Peqlab, Erlangen ViewPix 700 Scanner Biostep, Burkhardtsdorf Zeiss Axio Observer Z1 Inverted Microscope Zeiss, Jena Zeiss LSM800 Confocal Microscope Zeiss, Jena 2.12 Software Table 2.22: Software Name Source / distributor Adobe Photoshop CS 5 Adobe Systems GmbH, München CARA AG Wüthrich, ETH Zürich (CH) http://cara.nmr.ch/ CorelDraw 2019 Corel Corporation, Ottawa (CAN) CytoScape Cytoscape Consortium TEXStudio Free Software Foundation DrawTree 3.66 LIRMM, Montpellier (FRA) David Go Laboratory of Human Retrovirology 57 Chapter 2. Materials Name and Immunoinformatics, Frederick (USA) BibLATEX Free Software Foundation TEXlive Free Software Foundation ProtParam ExPasy, SIB Swiss Institute of Bioinformatics TranslateTool ExPasy, SIB Swiss Institute of Bioinformatics TOPSPIN 3.5 pl 5 Bruker, Karlsruhe Clustal Omega EMBL-EBI, Hinxton (GB) CAPITO Fritz Lipmann Institute, Leipzig OriginLab 7 OriginLab, Northampton (USA) 58 Chapter 3. Methods 3 Methods 3.1 General methods 3.1.1 Heat-shock transformation of E. coli bacteria 0.5 µL of plasmid DNA were added to 25 µL of competent E. coli BL21 (DE33) Gold or DH5α cells and incubated on ice for 30 min. Cells were heat shocked at 42 °C for 45 s and again incubated on ice for 2 min. Afterwards, 300 µL of LB-Medium were added and the cells were grown for 1 h at 37 °C and 225 rpm. Subsequently, the cells were plated onto an antibiotic containing agar plate and incubated over night at 37 °C. 3.1.2 Plasmid DNA preparation from E. coli An over night culture of E. coli DH5α cells was cultivated in 5 mL LB medium at 37 °C which contained the suitable amount of antibiotics. After centrifugation at 3900 rpm for 10 min at 4 °C the plasmid DNA was isolated with the E.Z.N.A Plasmid Mini Kit I (protocol I of instruction manual). DNA concentration was determined by absorption measurements at 260 nm with a ThermoScientific NanoDrop 2000c UV-Vis spectrophotometer. 3.1.3 Polymerase chain reaction (PCR) Modifications and amplifications of DNA fragments were performed via PCR. For this the Kapa HiFi HotStart PCR Kit and a Primus 25 thermo cycler were used. For more details on used oligonucleotides and methods see subsection 3.1.4 and tables 2.13 and 2.12. Prior to further usage, the template DNA was digested with DpnI, which specifically recognizes methylated 59 Chapter 3. Methods DNA. Furthermore the DNA was cleaned up with the GenepHlow Gel/PCR Kit and eluted in 30 µL ddH2O. Table 3.1: DpnI digestion reaction mixture Component Volume [µL] 10x Cutsmart buffer 5 ddH2O 22.5 DpnI 1 PCR reaction mixture 22.5 3.1.4 Gibson Assembly Gibson Assembly is a suitable method to merge linear DNA fragments to obtain, for example, new combinations of insert and vector DNA.79,80 After generation of linear DNA segments via PCR, annealing of the fragments is performed in a buffer which contains three different en- zymes. First, an exonuclease creates single-stranded 3’ overhangs for annealing purposes. The occurring gaps in the annealed DNA fragments are filled by a DNA polymerase and a DNA ligase covalently links the fragments. After incubation of the DNA fragments in the isothermal ligation reaction mix (see table 3.2) for 1 h at 50 °C, the DNA was transformed into E. coli DH5α cells and isolated as described in sections 3.1.1 and 3.1.2. Table 3.2: Reaction mixtures for Gibson Assembly Buffer/solution Ingredients 5x Isothermal Reaction Mix 0.5 M Tris-HCl pH = 7.5 0.5 M MgCl2 1 mM dNTP Mix 0.25 g/mL PEG-8000 0.5 M NAD+ Assembly Master Mix 1x Isothermal Master Mix 60 Chapter 3. Methods Buffer/solution Ingredients 0.5 U/µL T5 Exonuclease 0.3 U/µL Phusion DNA Polymerase 0.5 U/µL Taq DNA Ligase 3.1.5 Agarose gel electrophoresis To separate DNA with various sizes agarose gel electrophoresis was performed. 1 or 2 % (w/v) agarose gels were used. Visualization of the different DNA plasmids and fragments was achieved by ethidium bromide staining for at least 20 min and detection with UV-light. 3.1.6 DNA sequencing To confirm successful cloning of genes, DNA sequencing was performed by GENterprise GE- NOMICS (StarSEQ GmbH, Mainz). The primers from table 2.14 were used. The final sequenc- ing mixture contained 300 - 700 ng plasmid DNA and 1 µL sequencing primer (10 µM stock solu- tion, see also table 2.14) topped up to a total volume of 7 µL with ddH2O. 3.1.7 SDS polyacrylamide gel electrophoresis (SDS-PAGE) Proteins were separated according to their molecular weight with SDS-PAGE. For buffer compo- sitions see table 2.2. Amongst other methods (see also section 3.1.8), visualization of the pro- tein bands were accomplished by Coomassie staining. For the compositions of the Coomassie staining and destaining solution also see table 2.2. Table 3.3: Composition of the stacking and separation gel for SDS-PAGE Ingredients separation gel 15 % separation gel 12 % stacking gel ddH2O 4.6 mL 4.6 mL 4.6 mL 1.5 mM Tris-HCl pH 8.8 5 mL 5 mL / 61 Chapter 3. Methods Table 3.3: Composition of the stacking and separation gel for SDS-PAGE Ingredients separation gel 15 % separation gel 12 % stacking gel 1.0 mM Tris-HCl pH 6.8 / / 0.63 mL Acrylamid/Bisacrylamid 30 % 10 mL 8 mL 0.83 mL SDS 10 % (w/v) 0.2 mL 0.2 mL 0.5 mL APS 10 % (w/v) 0.2 mL 0.2 mL 0.5 mL TEMED 0.2 mL 0.2 mL 0.5 mL 3.1.8 Western blot and chemiluminescence detection After SDS-PAGE (see section 3.1.7) separated proteins were transferred onto a PVDF mem- brane with another electrophoresis step to detect specific proteins and/or their modifications, respectively, with an antibody mediated chemiluminescence reaction. Depending on the used antibodies, the membrane was incubated in different blocking solutions for 1 h at room temper- ature (see also 3.4). After three wash steps, each for 5 min at room temperature with PBS/T, the membrane was incubated in the particular peroxidase-coupled antibody solution (see also 3.5). Again, three wash steps were performed and chemiluminescence was induced with a 1:1-mixture of Roti®-Lumin reagents 1 and 2 detected either with a STELLA 3200 or GE Image- Quant CCD camera. Table 3.4: Used primary antibody solutions and blocking solutions Antibody solution Blocking solution (% in w/v) Anti-His6-HRP 1:5000 in 2 % (w/v) milk powder in PBS/T 5 % (w/v) milk powder in PBS/T Strep-POD 1:20 000 in 1 % (w/v) BSA in PBS/T 2 % (w/v) BSA in PBS/T Anti-ANXA2 in 1 % (w/v) milk powder in PBS/T 5 % (w/v) milk powder in PBS/T Anti-DDX3X 1:1000 in 1 % (w/v) milk powder in PBS/T 5 % (w/v) milk powder in PBS/T Anti-V5 mouse 1:5000 in 1 % (w/v) milk powder in PBS/T 5 % (w/v) milk powder in PBS/T Anti-myc mouse 1:1000 in 1 % (w/v) milk powder in PBS/T 5 % (w/v) milk powder in PBS/T Anti-FLAG rabbit 1:1000 in 1 % (w/v) milk powder in PBS/T 5 % (w/v) milk powder in PBS/T Anti-FLAG mouse 1:1000 in 1 % (w/v) milk powder in PBS/T 5 % (w/v) milk powder in PBS/T 62 Chapter 3. Methods Table 3.5: Used secondary antibody solutions Antibody solution Horse anti-mouse HRP-linked IgG 1:1000 in PBS/T Goat anti-rabbit HRP-linked IgG 1:1000 in PBS/T 3.1.9 Protein quantification To determine the protein concentrations various methods were used. Bradford assay With the Bradford Assay it is possible to obtain the concentration of protein in a sample via the quantitative assessment of the absorbance shift of Coomassie G-250 based on interactions between dye and proteins. As standards, increasing concentrations of BSA solutions were used (0 to 200 µg/µL). Absorption measurements Another method to assess the protein concentration of a sample is to measure the absorption at 280 nm with a ThermoScientific NanoDrop 2000c UV-Vis spectrophotometer due to the ab- sorption of aromatic amino acids (tyrosine, tryptophan, phenylalanine). Because the number of these aromatic amino acids are varying in each protein, the specific molar extinction coeffi- cients at 280 nm were computed using the ExPasy-ProtParam tool (http://web.expasy.org/ protparam/). 63 Chapter 3. Methods 3.1.10 Size exclusion chromatography Proteins were purified according to their size via size exclusion chromatography (SEC). Depend- ing on the sample volume and protein size, various columns were used (see table 3.6) Table 3.6: Used SEC columns, manufactured by GE Healthcare Column name column volume sample volume separation range HiLoad 16/600 Superdex 200 120 mL ≤ 5 mL 70 000 - 3000 Da HiLoad 16/600 Superdex 75 120 mL ≤ 5 mL 600 000 - 10 000 Da Superose™ 6 10/300 GL 24 mL ≤ 500 µL 5 000 000 - 5000 Da Columns were stored at 4 °C in 20 % (v/v) ethanol. SEC runs for each protein were also car- ried out at 4 °C and the columns were equilibrated in the appropriate SEC buffer before every protein purification. Chosen protein samples were adjusted to the desired sample volume with a centrifugal concentrator. Potential aggregates were removed by centrifugation at 3900 rpm and 4 °C for 10 min before loading it onto the SEC column. The sample was loaded onto a suitable loop and injected onto the column with a flow rate of 0.5 mL/min. Elution was per- formed isocratically for 1.1 CV. The flow rates during elution as well as the collected fraction size were adjusted to the individual proteins (see 3.7). The absorbence at 280 nm was de- tected and the purity of collected fractions verified via SDS-PAGE with subsequent Coomassie staining. 3.2 Cell culture of eukaryotic cells 3.2.1 Cultivation HEK293 cell strains (see table 2.20) were cultivated in 10 cm dishes at 37 °C, 5 % CO2 atmo- sphere and 95 % humidity with DMEM containing 10 % (v/v) FCS, 1 % (v/v) P/S and 1 % (v/v) L- Glutamine. HEK293-hsV4-cGFP were additionally treated with 0.500 µg/mL G-418 and 200 nM 64 Chapter 3. Methods TRPV4 inhibitor HC-067, HEK293-hsTRPML1-nGFP cells with 0.375 µg/mL G-418. Twice a week the cells were splitted in a ratio of 1:8. For splitting, the expended medium was aspi- rated and the cells were washed with 5 mL PBS. Afterwards, the cells were trypsinized with 1.5 mL trypsin/EDTA in 1.5 mL PBS and diluted to the desired ratio with fresh medium. The cells were then plated on fresh dishes. All media were warmed up to 37 °C in a water bath before use. 3.2.2 Transient transfection of HEK293T cells For transient transfection of HEK293T cells, 575 000 cells were seeded into 6-well plates per well 24 h before transfection. Cells were transfected according the Lipofectamin® LTX reagent protocol. For fluorescence microscopy (see section 3.3) and live calcium imaging (see 3.5) poly- L-lysinated cover slips were provided in the 6-well dish. Used plasmid DNAs are listed in table 2.15 and used plasmid DNA amounts for transfections in table 3.7. If not otherwise indicated, cells were incubated with the DNA/lipid complex for 24 h. Table 3.7: Used plasmid DNA amounts for transfections of HEK293T cells with Lipofectamine ® LTX Expressed construct Vector Plasmid DNA amount [ng/well] ggV4N-cGFP pcDNA3.1-cGFP 2000 ggV4N_aawaa-cGFP pcDNA3.1-cGFP 2000 ggV4N∆53-cGFP pcDNA3.1-cGFP 2000 ggV4N∆53_aawaa-CGFP pcDNA3.1-cGFP 2000 hsTRPV4-cGFP pcDNA3.1-cGFP 500 hsTRPV4 S134E-cGFP pcDNA3.1-cGFP 500 hsTRPV4 S134A-cGFP pcDNA3.1-cGFP 500 hsTRPV4 R232C-cGFP pcDNA3.1-cGFP 500 hsTRPV4 R269C-cGFP pcDNA3.1-cGFP 500 hsTRPV4 K276E-cGFP pcDNA3.1-cGFP 500 hsTRPV4 R315W-cGFP pcDNA3.1-cGFP 500 hsTRPV4 V342F-cGFP pcDNA3.1-cGFP 500 hsTRPV4 M680K-cGFP pcDNA3.1-cGFP 500 hsTRPV4-nFLAG pcDNA3.1-nFLAG 500 65 Chapter 3. Methods Expresssed construct Vector Plasmid DNA amount [ng/well] hsTRPV4-R269C-nFLAG pcDNA3.1-nFLAG 500 hsDDX3X-nV5 pcDNA3.1-nV5 1000 mmPACSIN1-nV5 pCAGIG-nV5 1000 mmPACSIN2-nV5 pCAGIG-nV5 1000 mmPACSIN3-nV5 pCAGIG-nV5 1000 hsPACSIN1-nV5 pCAGIG-nV5 500 hsPACSIN2-nV5 pCAGIG-nV5 500 hsPACSIN3-nV5 pCAGIG-nV5 500 hsPACSIN_F1_S2-nV5 pCAGIG-nV5 1000, 48 h hsPACSIN_F1_S3-nV5 pCAGIG-nV5 1000, 48 h hsPACSIN_F2_S1-nV5 pCAGIG-nV5 1000, 48 h hsPACSIN_F2_S3-nV5 pCAGIG-nV5 1000, 48 h hsPACSIN_F3_S1-nV5 pCAGIG-nV5 1000, 48 h hsPACSIN_F3_S2-nV5 pCAGIG-nV5 1000, 48 h mCherry pcDNA3.1 500 hsYAP1-nV5 pcDNA3.1-nV5 500 hsRUVBL1-myc pcDNA3.1-nmyc 500 3.2.3 Stable transfection of HEK293 cells To generate stable HEK293 cell lines stably expressing either hsTRPV4-cGFP or hsTRPML1- nGFP, HEK293 cells were transfected as previoulsy described (see 3.2.2). For used plas- mid DNA amounts, see table 3.8. Furthermore, after transfection, HEK293 cells expressing hsTRPV4-cGFP (HEK293-hsV4-cGFP), if not otherwise indicated, were always treated with 200 nM of the TRPV4 antagonist HC-067. 66 Chapter 3. Methods Table 3.8: Used plasmid amounts for stable transfections of HEK293 cells with Lipofectamine ® LTX Expressed construct Vector Plasmid DNA amount [ng/well] G-418 amount [µg/µL] hsTRPV4-cGFP pcDNA3.1-cGFP 500 0.500 hsTRPML1-nGFP pEGFP C3 2000 0.375 After 24 h incubation with the DNA/lipid complex, cells were examined for GFP-signals on a widefield Zeiss Axio Observer Z1 Inverted Microscope. If GFP-positive, cells were passaged for 2 weeks and selected with G-418 (see table 3.8), with G-418-containing media changes after every 48 h. Large, healthy and GFP-positive colonies were isolated with sterile tooth- picks and cultured for another 3 weeks in G-418 medium with media changes after every 48 h. With this, stably expressing, polyclonal cell lines were obtained. Proper protein expression, function and localization were confirmed with Western Blots with subsequent chemilumines- cence detection, fluorescence microscopy and Ca2+-influx assays. Generation of monoclonal cell lines failed, as the single cell transfer into 96-well plates resulted multiple times in cell death. 3.3 Immunostaining and fluorescence microscopy HEK293T or HEK293 cells were stably or transiently transfected with plasmid DNA encoding for the desired protein (see sections 3.2.2 and 3.2.3). To obtain insights in protein localization and protein-protein co-localization in cells, immunostaining was performed on the cells. Cells were washed three times with PBS containing 0.2 % (v/v) Tween®-20 (PBS/T), followed by an incuba- tion step with 50 mM NH4Cl in PBS for 10 min due to formaldehyde quenching. To permeabilize the cell membranes towards the staining antibodies or reagents, the cells were incubated in PBS containing 0.3 % (v/v) Triton-X for 15 min at RT and washed with PBS for 3 times. After discarding, the cells were incubated in 1 % (w/v) BSA in PBS/T for 30 min and washed with PBS/T for three times. If needed, primary antibodies diluted in 1 % (w/v) BSA in PBS/T (see table 3.9) were applied to the cells and incubated at 4 °C over night. After washing with PBS/T for three times, respective secondary antibodies in PBS/T were applied and incubated for 1 h 67 Chapter 3. Methods at RT. Again three washing steps with PBS/T were performed. For F-actin staining, cells were incubated for 1 h with Phalloidin-TRITC at RT and after 3 PBS/T washing steps, nuclei were stained with DAPI for 30 min at RT. The cells were washed again for three times with PBS/T and finally with pure PBS. The cell bearing cover slips were mounted on microscopic slides with Mowiol® 4-88 and kept in the dark until further usage. Table 3.9: Antibodies used for cell immunostainings Antibody Amount [µg/mL] Anti-ANXA2 mouse 2 Anti-DDX3X rabbit 2 Anti-FLAG rabbit 2 Anti-V5 mouse 2.5 Anti-myc mouse 2 Alexa-Fluor-488 goat anti-mouse 4 Alexa-Fluor-555 goat anti-rabbit 4 Alexa Fluor-647 goat anti-mouse 5 Alexa Fluor-647 goat anti-rabbit 5 Phalloidin-TRITC 50 Fluorescence microscopic images were obtained with a wide field Zeiss Axio Observer Z1 In- verted Microscope, kindly provided by Prof. Gerald Gimpl (Department of Chemistry, Biochem- istry Section, Johannes Gutenberg University, Mainz), or a Zeiss LSM800 Confocal Microscope (Microscopy Core Facility, JHU School of Medicine). The obtained pictures were extracted and processed with the biological-image analysis program Fiji.81 3.4 Co-Immunoprecipitation in eukaryotic cells Co-Immunoprecipitation (co-IP) is a straight-forward technique to evaluate protein complexes under physiological conditions. In this work, an antibody-based co-IP protocol with protein G- coated magnetic beads was performed. Transfected cells (see sections 3.2.2 and 3.2.3) were 68 Chapter 3. Methods washed three times with ice-cold PBS and then harvested with 1 mL/well of a 6-well plate. Cells were lysed with Pierce™Lysis Buffer supplemented with CST Protease/Phosphatase-Inhibitor. After two centrifugation steps at 4600 rpm and 13 900 rpm, respectively, for 15 min at 4 °C, the supernatant was transferred in a fresh, pre-chilled tube. The Protein G-coupled beads were coated with respective antibody for 15 min at RT and then were washed one time with PBS/T. After this, the antibody-coated beads were incubated with the supernatant for 2 h at 4 °C under mild rotation. Beads were then washed three times with PBS/T and finally, proteins were eluted from the beads with 1x SDS-PAGE sample buffer (see table 2.2) at 70 °C for 10 min. Samples then were subjected to SDS-PAGE and western blotting with subsequent chemiluminescence detection (see sections 3.1.7 and 3.1.8). 3.5 Live Ca2+ imaging Live calcium imaging (Ca2+ imaging) was performed on a Zeiss Axio Observer Z1 inverted microscope equipped with a Lambda DG-4 wavelength switcher. 24 h prior treatment, 6.8x105 cells/well were seeded int a 6-well plate, provided with Poly-L-coated cover slips in each well. 1 h prior treatment and Ca2+ imaging, cells were loaded with 2.5 µM Fura2 AM for 60 min at 37 °C. For hypotonic treatment, three volumes of hypotonic aCSF (see 2.2) was added to one volume of aCSF (see table 2.2 for buffer composition). For GSK-101 treatment, GSK-101 was added directly to the aCSF buffer. Cells were imaged every 10 seconds for 1 min prior to stimulation with hypotonic saline or GSK-101, then imaged every 10 seconds for an additional 8 min. Calcium levels at each time point were computed by determining the ratio of Fura-2 AM emission at 380 nm divided by the emission at 340 nm. Data are respresenting raw the Fura ratio. 3.6 Ca2+ influx assay To assure the functionality of stably transfected human TRPV4-cGFP (see also section 3.2.3), fluorescence-based Ca2+ influx assays were performed with the Fluo-4 Direct Calcium Assay on a FlexStation 3 MultiMode Plate Reader. Poly-L-lysinated 96-well plates were seeded with 40 000 cells/well and after 24 h, cells were loaded with Fluo-4 Direct™calcium reagent loading 69 Chapter 3. Methods solution according to the manufacturers protocol. After incubation for 1 h at RT, 5 % CO2 atmo- sphere and 95 % humidity, cells were treated with 30 nM GSK-101 end concentration. Resulting fluorescence signals were measured every 3 s for 3 min at RT with an excitation wavelength at 494 nm, an emission wavelength 516 nm and a bandwidth of 1 nm. 3.7 Recombinant expression and purification of constructs 3.7.1 Recombinant expression of human N-terminal TRPV4 (hsV4N) constructs E. coli BL21 (DE3) Gold cells were heat-shock transformed (see section 3.1.1) with the respec- tive plasmid (see table 2.15). In an over night incubation at 37 °C and 225 rpm a preculture in 50 mL LB medium containing 100 µg/mL ampicillin was set up. Subsequently, 1 L TB medium with 0.2 % (v/v) glucose or LB medium were supplemented with 100 µg/mL ampicillin and inoc- ulated with 2 % (v/v) of preculture. The cells were then grown at 37 °C and 225 rpm to an OD600 of 0.6. Used IPTG concentrations and conditions for protein expression are listed in table 3.10. The cells were harvested by centrifugation at 5000 rpm and 4 °C for 10 min. After disposing the supernatant, the cell pellet was frozen with liquid nitrogen and stored at −20 °C until further use. Table 3.10: Expression conditions of human N-terminal TRPV4 (hsV4N) constructs. hsV4N∆132 is also referred to as hsV4 ARD, hsV4N∆122 as hsV4 ARD-PRR. Avi2 = c-terminal avidin-tag followed by a His6-tag. IPTG conc. = IPTG concentration, Temp. = Temperature Construct Medium IPTG conc. [µM] Duration [h] Temp. [°C] hsV4N-His6 TB 150 16 20 hsV4N R232C-His6 LB 150 16 20 hsV4N-Avi2 TB 150 16 20 hsV4N∆122-His6 LB 75 16 20 hsV4N∆132-His6 LB 75 18 20 hsV4N∆132 R232C-His6 LB 75 18 20 hsV4N∆132 R269C-His6 LB 75 18 20 hsV4N∆132 D333G-His6 LB 75 18 20 hsV4N∆132-Avi2 LB 75 16 20 70 Chapter 3. Methods Construct Medium IPTG conc. [µM] Duration [h] Temp. [°C] hsV4N∆132 R232C-Avi2 LB 75 18 20 hsV4N∆132 K276E-Avi2 LB 75 18 20 hsV4N∆132 V342F-Avi2 LB 75 18 20 The below mentioned purifications were all carried out at 4 °C. 3.7.2 Purification of hsV4N constructs The cell pellet of a 1 L E. coli cell culture was suspendend in 100 mL E. coli lysis buffer (for all buffer compositions see 2.2). Sonification was performed on ice with a Branson Sonifier 250 using a duty cycle of 5 for 50 s. The cell lysate was cleared via centrifugation at 20 000 rpm and 4 °C for 40 min. The obtained supernatant was loaded onto 1 mL Ni2+-NTA agarose provided in a column which was equilibrated with 2 CV Ni2+-NTA buffer 20 beforehand. The flow through was discarded and the Ni2+-NTA agarose then washed with 20 CV Ni2+-NTA buffer 20, followed by a second and a third wash step with 1 CV Ni2+-NTA buffer 50 and 1 CV Ni2+-NTA buffer 75, respectively. The His6-tagged protein was eluted with 9 CV Ni2+-NTA buffer 500 and collected in 1 mL fractions, to which 1 mM DTT and 1 mM EDTA were added. Protein purity was analyzed via SDS-PAGE using a 12 % gel. The protein was further subjected to size exclusion chromatog- raphy with a HiLoad 16/600 Superdex 200 SEC column, whereas elution was performed over 1.1 CV with SEC buffer hsV4N and collected in 0.5 mL fractions. If necessary, a second SEC with the before purified fractions was performed with SEC buffer hsV4N containing 750 mM NaCl. Purity was analyzed via SDS-PAGE and Coomassie staining. 3.7.3 Purification of hsV4∆N122 and hsV4∆N132 constructs hsV4N∆132 is also referred to as hsV4 ARD, hsV4N∆122 as hsV4 ARD-PRR. The same purification protocol as described in subsection 3.7.2 above was used. The last wash step (W3) was left out, also 10 elution steps with Ni2+-NTA buffer 500 were performed. For human RhoA interaction studies via NMR with 15N-labeled human RhoA (see section 4.4), the SEC of hsV4N∆132 R232C-His6 was performed with the SEC buffer of RhoA (see table 2.4). 71 Chapter 3. Methods 3.7.4 Biotinylation and purification of hsV4N constructs With the insertion of the 15 amino acids containing (GLNDIFEAQKIEWHE) avidin tag (Avi) in the protein of interest it is possible to achieve a specific biotinylation of the desired protein in vivo with the E. coli biotin ligase BirA. BirA covalently attaches a single biotin to the lysine residue of the avidin tag. The femtomolar affinity constant between biotin and streptavidin can be ex- ploited for further purposes, purification attempts example.82 In previous works of the research group Hellmich, an avidin tag was inserted on two different positions in hsV4N and hsV4N ∆N132: either before the C-terminal His6-tag (hsV4N Avi2) or after the C-terminal His6-tag (hsV4N Avi3).76 For biotinylation of the avidin tagged proteins, E. coli BL21 (DE3) Gold cells were heat-shock co-transformed with the respective plasmids, one expressing the BirA ligase (p155) and the other the respective TRPV4 N-terminal construct. Cell cultivation and protein ex- pression were similar as described in section 3.7.1. Additionally, 40 µM biotin were added to the growth medium to ensure sufficient biotinylation of the target protein.82 Purification of biotinylated human N-terminal TRPV4 constructs The same purification protocol as described in subsection 3.7.2 above was used with minor deviations. The last wash step (W3) was left out, furthermore 6 elution steps with Ni2+-NTA buffer 500 were performed. SEC were executed with a ENrich™ SEC 70 column. Purity was analyzed via SDS-PAGE and Coomassie staining. Successful biotinylation was determined during the purification via dot-blot with a streptavidin-POD (Strep-POD) antibody and also a western blot with the same Strep-POD antibody was performed to verify the correct molecular weight as described previously.76,77 3.7.5 Recombinant expression and purification of human RhoA The same expression protocol as described in section 3.7.1 was used. Protein expression was induced at an OD600 of 0.8. Table 3.11 lists the further expression conditions used for human RhoA in this work. 72 Chapter 3. Methods Table 3.11: Expression conditions of human RhoA. IPTG conc. = IPTG concentration, Temp. = Temperature Construct Medium IPTG conc. [µM] Duration [h] Temp. [°C] human RhoA-His6 LB 250 18 16 The same purification protocol as in subsection 3.7.2 was used with buffer conditions suited to human RhoA (see also table 2.4). Furthermore, if needed, a TEV-cleavage was performed over night to remove the n-terminal His6-tag (see also table 2.4 for buffer conditions) with subsequent reverse IMAC. Reverse IMAC washing steps were performed until the OD280 dropped below 0.4. Concentrated protein containing fractions were then subjected to SEC. 3.7.6 Recombinant expression and purification of human DDX3X_aa122-582 (DDX3X) The same expression protocol as described in section 3.7.1 was used, but here the used an- tibiotic was Kanamycin with end concentrations of 50 µg/mL. Protein expression was induced at an OD600 of 0.8. Table 3.12 lists the further expression conditions used for hsDDX3X in this work. Table 3.12: Expression conditions of hsDDX3X. IPTG conc. = IPTG concentration, Temp. = Temperature Construct Medium IPTG conc. [µM] Duration [h] Temp. [°C] human DDX3X_aa122-582-His6 LB 1000 18 25 The same purification protocol as in subsection 3.7.2 was used with buffer conditions suited to hsDDX3X (see also table 2.5). Furthermore, the IMAC was differently performed as described 73 Chapter 3. Methods in the following. The obtained supernatant after cell lysis and centrifguation of 1 L E. coli cell culture was loaded onto 3 mL Ni-2+-NTA agarose provided in a column which was beforehand equilibrated with 2 CV IMAC Wash A buffer. After discarding the flow-through the Ni-2+-NTA agarose was washed with 15 mL IMAC wash buffer A, followed by 10 mL IMAC High salt buffer and 10 mL IMAC Wash B buffer. Elution steps were performed with IMAC Elution buffer until the OD280 dropped below 0.3. Furthermore, if needed, a TEV-cleavage was performed over night to remove the n-terminal His6-tag (see also table 2.5 for buffer conditions) with subsequent reverse IMAC. Reverse IMAC washing steps were performed until the OD280 dropped below 0.2. Concentrated protein containing fractions were then subjected to SEC. 3.7.7 Recombinant expression and purification of human ITCH The same expression protocol as described in section 3.7.1 was used. Protein expression in the cells were induced at an OD600 of 0.8. Table 3.13 lists the further expression conditions used for human ITCH in this work. Table 3.13: Expression conditions of human ITCH. IPTG conc. = IPTG concentration, Temp. = Temperature Construct Medium IPTG conc. [µM] Duration [h] Temp. [°C] human ITCH-nHis6 LB 250 18 16 The same purification protocol as in subsection 3.7.2 was used with buffer conditions suited to human ITCH (see also table 2.6) with the minor deviaton during the IMAC, where three times twice the CV was eluted. Furthermore, if needed, a TEV-cleavage was performed over night to remove the n-terminal His6-tag (see also table 2.6 for buffer conditions) with subsequent reverse IMAC. Reverse IMAC washing steps were performed until the OD280 dropped below 0.4. Concentrated protein containing fractions were then subjected to SEC. 74 Chapter 3. Methods 3.7.8 Recombinant expression and purification of human ITCH WW domains The same expression protocol as described in section 3.7.1 was used. Protein expression in the cells were induced at an OD600 of 0.8. Table 3.14 lists the further expression conditions used for human ITCH WW domains in this work. Table 3.14: Expression conditions of human ITCH WW domains. IPTG conc. = IPTG concen- tration, Temp. = Temperature Construct Medium IPTG conc. [µM] Duration [h] Temp. [°C] hsITCH_WW1 domain-His6 LB 250 20 16 hsITCH_WW2 domain-His6 LB 250 20 16 hsITCH_WW3 domain-His6 LB 250 20 16 hsITCH_WW4 domain-His6 LB 250 20 16 hsITCH_WW1+WW2 domains-His6 LB 250 20 16 hsITCH_WW3+WW4 domains-His6 LB 250 20 16 The same purification protocol as in subsection 3.7.2 was used with buffer conditions suited to human ITCH WW domains (see also table 2.7), with just three elution steps during the IMAC. Furthermore, if needed, a TEV-cleavage was performed over night to remove the n-terminal His6-tag (see also table 2.6 for buffer conditions) with subsequent reverse IMAC. Reverse IMAC washing steps were performed until the OD280 dropped below 0.2. Concentrated protein con- taining fractions were then subjected to SEC. 3.7.9 Recombinant expression and purification of human YAP-WW domains The same expression protocol as described in section 3.7.1 was used. Protein expression in the cells were induced at an OD600 of 0.8. Table 3.15 lists the further expression conditions used for human YAP WW domains in this work. 75 Chapter 3. Methods Table 3.15: Expression conditions of human YAP WW domains. IPTG conc. = IPTG concentra- tion, Temp. = Temperature Construct Medium IPTG conc. [µM] Duration [h] Temp. [°C] hsYAP1_WW1 domain-His6 LB 250 16 20 hsYAP1_WW2 domain-His6 LB 250 16 20 hsYAP1_WW1+WW2 domains-His6 LB 250 16 20 The same purification protocol as in subsection 3.7.2 was used with buffer conditions suited to human YAP WW domains (see also table 2.9), with just three elution steps during the IMAC. Furthermore, if needed, a TEV-cleavage was performed over night to remove the n-terminal His6-tag (see also table 2.6 for buffer conditions) with subsequent reverse IMAC. Reverse IMAC washing steps were performed until the OD280 dropped below 0.2. Concentrated protein con- taining fractions were then subjected to SEC. 3.8 Pulldown assay of biotinylated hsV4N constructs All steps of the below mentioned pulldown assay were carried out at 4 °C. HEK293 cells of a 10 cm dish were cultivated until 90 % confluency. After discarding the supernatant, cells were washed once with 5 mL ice-cold PBS and incubated for 10 min in pulldown lysis buffer (see table 2.2) under mild agitation. Due to the short incubation in the digitonin-containing pulldown lysis buffer, the plasma membrane of the HEK293 cells permeabilizes, allowing cytosolic proteins to diffuse into the supernatant of the cells without destroying other cell compartments.83 The supernatant of the still adherent cells was then transferred into a fresh tube and centrifuged for 10 min at 400 rpm. The supernatant again was transferred into a fresh tube and centrifuged for 30 sec at 12 000 rpm. The supernatant was transferred into a fresh tube and the protein con- centration was determined via a Bradford Assay (see also sec 3.1.9). 20 µL streptavidin-coated magnetic beads were pre-incubated with 500 ng the respective non- or biotinylated N-terminal TRPV4 protein for 30 min at 4 °C under mild rotation. After three washing steps with PBS, the pre-loaded beads were incubated in 250 µg of the digitonin-extracted HEK293 cytosolic fraction. 76 Chapter 3. Methods To mimic an activation of the TRPV4 cation channel function, some samples were supplemented with 2 mM CaCl2. After an incubation for 30 min at 4 °C under mild rotation, beads were washed again three times with PBS and flash-frozen in liquid N2 until further use. 3.9 Mass spectrometry Mass spectrometry based proteomics became an indispensable tool for the analysis of proteins and their interaction partners. Several methods have been developed to investigate the complex networks of cell proteomes. In cooperation with Dr. Ute Distler (AG Tenzer, FZI Core Facility for Mass Spectrometry, Mainz) it was possible to approach towards an investigation of the human TRPV4 N-terminus interactome via ultra high-definition mass spectrometryE (UDMSE). There are several methods to prepare samples for mass spectrometry. In this work, samples were obtained either after in-gel digestion (see subsection 3.9.1) or in-solution digestion (see sub- section 3.9.2) after pulldown experiments with magnetic streptavidin beads (see section 3.8). Digestions (see sections 3.9.1 and 3.9.2) were kindly performed by Ruben Spohrer (AG Tenzer, FZI Core Facility for Mass Spectrometry, Mainz), MS measurements and data processing by Dr. Ute Distler (AG Tenzer, FZI Core Facility for Mass Spectrometry, Mainz). 3.9.1 In gel digestion After SDS-PAGE and Coomassie staining, the protein lanes of interest were cut out of the gel and added to 200 µL 50 mM NH4HCO3 buffer in 50 % acetonitrile (ACN), followed by incubation in an ultrasonic bath for 5 min. The supernatant was discarded and the foregoing step was repeated. 200 µL 100 % ACN were added to the left gel pieces and again incubated in an ul- trasonic bath for 5 min. The supernatant was discarded again and 100 µL 1 mM DTT solution were added to the gel pieces, followed by an incubation for 60 min at 56 °C. After cooling down the sample to RT, 100 µL iodoacteamide (IAA,c= 10 mg/mL) were applied and incubated for 45 min under light exclusion, followed by another addition of 100 µL 50 mM NH4HCO3 buffer in 50 % acetonitrile (ACN) and incubation in an ultrasonic bath for 5 min. After discarding the supernatant the last step was repeated. Afterwards, the gel pieces were incubated in 100 µL 100 % ACN in an ultrasonic bath for 5 min. The supernatant was discarded, the gel pieces heated at 56 °C for 1 min and then 25 µL trypsin solution (dilution 1:100) were added. Incuba- tion was performed over night at 37 °C and the supernatant was added in an ice cooled tube 77 Chapter 3. Methods in which all following supernatants were collected. Now, the remaining gel pieces were incu- bated in 50 µL 50 % ACN solution with 1 % formic acid (FA) in an ultrasonic bath for 15 min. This step was performed twice, each time the supernatant was collected in the before mentioned tube. 100 µL 100 % ACN were then added to the gel sample and again incubated in an ultra- sonic bath for 15 min. The supernatant was collected again and the gel pieces were discarded, followed by an incubation of the collected supernatants for 30 min at −80 °C. The collected supernatants were then concentrated to a volume of 20 µL with a vacuum concentrator. and then centrifuged at 13 000 rpm for 15 min at 4 °C. 15 µL of the supernatant were then added to 5 µL Enolase (100 fmol) and 5 µL 1 % FA. This mixture was then ready for mass spectrometric measurements. 3.9.2 In-solution digestion To obtain samples for mass spectrometric measurements after the pulldown assay described in section 3.8, an in-solution digestion was performed. Proteins were precipitated with the "Pro- teoExtract™Protein Precipitation Kit" (Merck Millipore, Darmstadt). 1 % RapiGest SF Surfactant solution were added ( 110 of sample volume ) followed by an incubation for 15 min at 80 °C. 8 mM DTT were added to the sample, incubated for 15 min at 56 °C, followed by the addition of 15 mM IAA and an incubation at RT for 45 min. 1 µL trypsin and 8 mM DTT were added and incu- bated over night at 37 °C . The pH of the sample was lowered to 3 with 1 M HCl an the sample incubated for 10 min at 37 °C. After centrifugation for 30 min at 130 000 rpm and 4 °C, 10 µL su- pernatant were mixed with 5 µL Enolase (100 fmol) and 10 µL 1 % FA to yield samples ready for MS measurements. 3.9.3 Liquid Chromatography Mass Spectrometry After tryptic digestion (see subsections 3.9.1 and 3.9.2) the peptides were separated via nanoU- PLC with a nanoAcquity UPLC system (Waters Corporation, Milford) on an Acquity UPLC HSS- T3 reverse phase column (high silica strength, 75 µm × 250 µm 1.8 µm), which was equilibrated with Mobile Phase A (see table 2.2). In direct injection mode sample volumes between 0.7 µL and 0.6 µL were applied onto the reverse phase column, followed by a gradient flow of 5-40 % with Mobile Phase B over 90 min at a flow rate of 300 nL/min and a column temperature of 78 Chapter 3. Methods 55 °C. Afterwards the column was washed with 90 % of Mobile Phase B and furthermore re- equilibrated. A nano-ESI-Q-TOF mass spectrometer (Synapt G2-S HDMS, Waters Corporation) with an ion mobility separation (IMS) device was used for MS analysis performed in positive mode ESI. LC- MS data were collected in DIA mode using MSE combined with IMS (HDMSE) as well as in DDA mode using a top 10 method selecting the 10 most abundant ions for fragmentation.63 3.9.4 Data Processing and Protein Identification LC-MS DIA data were processed and searched with ProteinLynx Global SERVER (PLGS) (ver- sion 3.02 built 5 from Waters Corporation). DDA data were processed using using the software package PEAKS (version 8, Bioinformatic Solution Inc., Waterloo, Canada). Protein identifi- cation was obtained searching a custom compiled database containing UniProtKB/SwissProt entries of the E.coli and human reference proteomes (entries: 4434 E. coli, 20 231 human) as well as the sequences of the N-terminal TRPV4 constructs. Sequence information for eno- lase (Saccharomyces cerevisiae) and common contaminants (e.g. human keratins, BSA, and trypsin) were added to the databases. Identified peptides had to match several search crite- ria: 1. Trypsin had to be the digestive enzyme. 2. Up to two missed cleavages were allowed. 3. Carbamidomethyl cysteine was defined as a fixed modification. 4. Methionine oxidation was defined as a variable modification. 5. Peptides had to have a minimum length of six amino acids. The false discovery rate (FDR) for peptide and protein identification was assessed searching a reversed database. FDR was set to a 1 % threshold for database search in PLGS and PEAKS. HDMSE collected data were post-processed with the in-house software ISOQuant in order to facilitate the data analysis.63 79 Chapter 3. Methods 3.10 Enzymatic assays To validate the enzymatic activity of the recombinantly expressed and purified enzymes in the course of this work, enzymatic assays were performed as described below. 3.10.1 GTPase assay Intrinsic GTPase activity of recombinantly expressed and purified human RhoA (see also sub- section 3.7.5) was determined via the GTPase-Glo Assay (see also table 2.18) according to the manufacturers protocol. Luminescence was recorded with a FLUOStar Omega Microplate Reader (BMG Labtech). In this assay, GTPase activity is inversely correlated to the measured amount of luminescence. 3.10.2 ATPase assay ATPase activity of recombinantly expressed and purified hsDDX3X (see als subsec3.7.6) was determined via an cuvette-based in vitro-ATPase assay. The ATPase assay used in this work is based on the enzyme-linked regeneration of ADP to ATP coupled to the oxidation of NADH to NAD2.The decrease of NADH and therefore the ATPase dependent hydrolysis of ATP can be determined with photometric measurements at 340 nm.84 For this, the components of ta- ble 3.16 were mixed together in a cuvette with HEPES buffer (pH = 7). After 30 s 1 mM ATP was added to the mixture and due to the ATPase-dependent RNA-Helicase Activity of DDX3X, the mixture was supplemented with 1 µM palindromic duplex RNA after 5 min ′(Sequence: 5 - 3′UUUUUUUUUUUUUUUUUUUUGGCGGCCGCC- ). As a control, the well-characterized B. subtilis ATPase BmrA was also supplemented with hsV4 ARD to rule out unspecific effects on the lactate dehydrogenase and pyruvate kinase involved in this assay. Measurements were carried out at RT with a Perkin-Elmer Lambda 25 Photometer. Table 3.16: Sample composition for the in vitro-ATPase assay Component MgCl2 1 µM Ascorbinic acid 1 µM 80 Chapter 3. Methods Component Phosphoenolpyruvate 3 µM Pyruvate kinase 0.05-0.08 units/µL Lactate dehydrogenase 0.08-0.12 units/µL hsDDX3X 3 µM BmrA 3 µM hsV4N construct 12 µM duplex RNA 1 µM ATP 1 µM 3.10.3 Ubiquitinylation assay To determine the E3 Ubiquitin ligase activity of recombinantly expressed and purified human ITCH (see also subsection 3.7.7) an in vitro-ubiquitinylation assay was performed. For this, the components of table 3.17 were incubated at 30 °C for up to 3 h in 10 mM Tris (pH=7.4) with 5 mM MgCl2. Out of this mixture, samples were taken after several time points for subsequent SDS-PAGE and Coomassie staining. Table 3.17: Sample composition for the in vitro-Ubiquitinylation assay Component Concentration [µM] ATP 5000 Ubiquitin 100 E1 Ubiquitin ligase UBE1 2 E2 Ubiquitin ligase Ubc5Hc 1 E3 Ubiquitin ligase ITCH 10 hsV4N construct 20 81 Chapter 3. Methods 3.11 Blue Native-PAGE (BN-PAGE) BN-PAGE is a straight-forward way to identify direct protein-protein interactions, especially for proteins which isoelectrical points are > 8, as these proteins do not migrate in a PAGE under Laemmli-conditions.85 Here, Coomassie G-250 is added into the discontinuous PAGE to create a net negative charge to allow protein migration towards the anode. In this work, BN-PAGE was used to determine the minimal binding side of ITCH at hsV4N. For this, 10 µM ITCH and 20 µM of the respective hsV4N construct were mixed in a tube with 10 mM Tris (pH=7.4) sup- plemented with 5 mM MgCl2 as reaction buffer. The protein mixture was incubated at 30 °C for 1 h. After this, the protein mixture was supplemented with Coomassie G-250 to an end concen- tration 0.25 % (w/v). The PAGE were run with 4 - 15 % Mini-Protean® TGX™ Precast Protein Gels with a electrophoresis cathode buffer (see table 2.2) for 3 h at 4 °C.Ater this, Coomassie staining was performed and relevant bands were cut out to provide them for mass spectromet- ric verification (Mass Spectrometry Core Facility, Johns Hopkins School of Medicine, Baltimore, USA). 3.12 Circular dichroism (CD) spectroscopy Circular dichroism (CD) measurements were performed on a Jasco-815 CD spectrometer with a spectral range between 195 and 260 nm at 20 °C. The scanning intervals were set to 1 nm, the scanning speed to 50 nm/min and the band-width to 5 nm. CD data are often reported as a mean residue ellipticity [Θ] 2 -1mrw,λ (deg cm dmol ). The conversion from the measured ellipticity Θ (deg) to the mean residue ellipticity [Θ]mrw,λ is described by equation 3.1. [Θ]mrw,λ = MRW · [Θ] 10 (3.1)· c · d Mean residue weight (MRW) is calculated with MRW = MN−1 , were M is the molecular weight in Dalton and N is the amino acid number of the measured protein. The secondary structure content was predicted with analyzing the CD spectra with the CAPITO tool (https://capito. uni-jena.de).The Chou-Fassmann algorithm predicts secondary structures based on empiric data in which amino acids show preferences for distinct secondary structures. Furthermore, 82 Chapter 3. Methods CAPITO compares the measured spectra with basis spectra data sets. A nearest-neighbor approach determines the 25 best matching references curves defined by closest proximity. At last, the lowest area differences are compared to reference curves. 3.13 NMR spectroscopy To obtain uniformly 15N-labeled proteins for 15N-HSQC spectra, E. coli BL21 Gold cells were transfected and the proteins expressed as described in sections 3.1.1 and 3.7, however, the cells were grown in M9 medium (see table 2.2) to ensure that 15NH4Cl is the only nitrogen source for protein expression. NMR spectra of respective proteins were recorded at 25 °C on Bruker AVANCE 600, 700 and 800 MHz spectrometers equipped with cryogenic triple reso- nance probes (Bruker, Karlsruhe) at the Centre for Biomolecular Magnetic Resonance (BMRZ) (Goethe-University, Frankfurt a.M.). 1H,15N-HSQC spectra were measured using standard pulse sequences and processed using TOPSPIN 3.5 (Bruker, Karlsruhe).86 3.14 Cross-linking mass spectrometry (XL-MS) XL-MS is a powerful tool for investigations of protein-protein interactions (PPIs) and the inter- faces of these interaction. Due to the chemical cross-linking between functional groups of amino acid side chains XL-MS is advantageous to capture and identify weak or transient PPIs. Here, H12/D12-disuccinimidyl suberate (H12/D12-DSS) was used, cross-linking between the amide groups of lysines. Purified (hsV4N and DDX3X as well as hsV4N and ITCH) proteins were mixed in a molar ratio of 1:1 to a final concentration of 1 mg/mL in 100 µL. H12/D12-DSS was freshly dissolved in DMF prior use and added to the protein mixture at a final concentration of 1.5 mM. The cross-linking reaction was incubated for 2 h on ice and quenched with the addition of am- monium bicarbonate at a final concentration of 500 mM. The mixture was further incubated on ice for additional 2 h. Samples were flash-frozen in liquid nitrogen and stored at -20 °C until further use. Sample processing, MS measurements and analysis were kindly carried out by M. Sc. Jasmin Jansen (Working group Stengel, University of Konstanz).87 83 Chapter 4. Results 4 Results 4.1 A beginning to elucidate the versatile TRPV4 N-terminal protein interactome - the tip of the iceberg 4.1.1 Purification of biotinylated TRPV4 N-terminal proteins The protein interactome of a cell is not a static structure of probable binary protein-protein in- teractions (PPIs). It is a reflection of the cells state and therefore indicates protein abundance, post-translational modifications, cell cycle phase or the stress level of a cell. Due to this broad variety of possible conditions, the protein interactome of a cell is very dynamic and specific biochemical methods can only yield snapshots of protein interactions in certain biological situa- tions. To obtain a comprehensive view of the protein interactome, shotgun mass spectrometry is the method of choice.73,88 This work focuses on the protein interactome of the full-length TRPV4 N-terminus (here referred to as hsV4N), as this portion of the full-length ion channel is a notorious hot-spot for disease-causing point mutations.27,56,89,90 Furthermore, hsV4N plays an integral role in channel sensitization as well as desensitization and harbors a number of pivotal protein, lipid and small molecule interaction sites, like a phosphoinositide binding do- main (PBD) and a proline rich region (PRR), which are followed by six α-helical ankyrin re- peats, the ankyrin repeat domain (ARD).22,39 Previously, a protocol was established to obtain the hsV4N protein interactome after pulldown assays in HEK293 cell lysates followed by shot- gun proteomics performed in cooperation with Dr. (RG University Medicine Mainz, JGU Mainz).76 This protocol required recombinant expression, in vivo biotinylation as well as protein integrity investigations of several TRPV4 N-terminal constructs with an so-called avidin- tag (here referred as Avi). This tag allows side-specific in vivo biotinylation of a lysine in the avidin-tag itself (single letter code avidin-tag: GLNDIFEAQKIEWHE).91 In addition to 84 Chapter 4. Results the already used and validated full-length hsV4N with avidin-tag (hsV4N wt Avi), before men- tioned protocol was optimized for the TRPV4 ankyrin repeat domain (here referred as hsV4 ARD), including the selected disease-causing mutations R232C and K276E (figure 4.1). The TRPV4 R232C mutation leads to Charcot-Marie-Tooth Type 2C (CMT2C)54, whereas TRPV4 K276E results in fetal akinesia - a combined phenotype of metatropic dysplasia with putative neurodegenerative symptoms.92 Protein expression, in vivo biotinylation and purifications were performed as described in subsection 3.7.4. All size exclusion chromatograms (SEC) of used TRPV4 N-terminal constructs in figure 4.1 show narrow gaussian peaks with expected elu- tion volumes for all biotinylated proteins (see section 6.2 for SEC purification of unbiotinylated proteins). Coomassie stained SDS-PAGEs show pure proteins and a Streptavidin-Peroxidase (Strep-POD) dot-blot confirms successful biotinylation. However, hsV4N wt Avi shows a sig- nificant stronger signal in the Strep-POD dot blot than the hsV4 ARD Avi constructs. Image analysis of the Strep-POD dot blots with Fiji shows a 90 % weaker biotinylation efficacy of the hsV4 ARD Avi constructs compared to hsV4N Avi (data not shown). Adjustment of the used hsV4 ARD Avi concentrations was sufficient enough for successful pulldowns due to the strong interaction between biotin and streptavidin with a K in the femtomolar range.91,94–96D CD spec- tra show, as also previously reported22, that hsV4N consists of a large α-helical part, which is contributed by the ARD (aa 149 - aa 398), and a large unstructured region (aa 1-aa 149). Com- parison of the CD spectra between biotinylated and non-biotinylated hsV4 ARD Avi constructs shows no change in the α-helical structure, which is also underlined by secondary structure pre- diction via CAPITO93. Only biotinylated hsV4N wt Avi supposedly harbors a marginal β-sheet Figure 4.1 (facing page): Purification of in vivo biotinylated and structural intact TRPV4 N-terminal constructs. A Schematic topology model of TRPV4 N-terminal constructs used for protein interactome investigations via pulldown assays and subsequent mass spectrometry in this work. HsV4N represents the full-length human TRPV4 N-terminus with important interaction sites like the phosphoinositide binding site (PBD), proline rich region (PRR) and the ankyrin repeat domain (ARD). Avi = avidin tag (single letter code: GLNDIFEAQKIEWHE). His6 = hexa-histidine tag (single letter code: HHHHHH). B SEC purifications of biotinylated hsV4N wt Avi and hsV4 ARD Avi constructs. SEC runs were either performed with a HiLoad Superdex 200 pg or a HiLoad Superdex 75 pg preparative SEC column. Inlets show Coomassie stained 15 % SDS-PAGEs of collected and concentrated fractions after SEC, furthermore a Strep-POD dot blot indicating biotinylated proteins of the respective proteins. x-axis: eluted volume in mL, y-axis: absorbance at 280 nm, M = marker in kilodalton (kDa). C Comparison of far UV CD spectra of purified biotinylated and non-biotiynlated hsV4N constructs. Spectra were measured at 293 K and proteins were used at 2µM concentration in SEC buffer with a final concentration of 30 mM NaCl. Inlets show secondary structure prediction performed with CAPITO.93 The predicted α-helix/β-sheet/random coil content of the purified proteins is for non-biotinylated hsV4N wt Avi 53 %/0 %/46 %, hsV4 ARD wt Avi 76 %/0 %/24 %, hsV4 ARD R232C Avi 74 %/0 %/26 % and hsV4 K276E Avi 76 %/0 %/24 %. Biotinylated proteins show the following secondary structure content distribution: hsV4N wt Avi 40 %/14 %/46 %, hsV4 ARD wt Avi 76 %/0 %/24 %, hsV4 ARD R232C Avi 74 %/0 %/26 % and hsV4 ARD K276E Avi 76 %/0 %/24 %. x-axis: mean residue ellipticity ([Θ] −3 2mrw,λ) in 10 deg cm dmol−1, y-axis: wavelength λ in nm. 85 Chapter 4. Results A 149 398 hsV4N wt Avi N PBD PRR ARD Avi His C6 hsV4 ARD wt Avi N ARD Avi His C6 R232C hsV4 ARD R232C Avi N ARD Avi His C6 K276E hsV4 ARD K276E Avi N ARD Avi His C6 B 350 hsV4N wt Avi biotinylated 150 hsV4 ARD wt Avi hsV4 ARD R232C Avi hsV4 ARD K276E Avi 300 M biotinylated M [kDa] Coomassie Strep-POD [kDa] Coomassie Strep-POD 250 100 wt 200 50 50 37 37 R232C 150 25 25 wt C 50 E32 6 K276E2 R 2 7 100 K 50 Superdex 200 Superdex 75 0 0 40 50 60 70 80 90 100 40 50 60 70 80 90 100 Volume [mL] Volume [mL] C 1 .0 1 .0 random coil 60 hsV4N wt Avi 60 hsV4N wt Avi random coil 0 .9 b-sheet 0 .9 b-sheet hsV4 ARD wt Avi a-helix hsV4 ARD wt Avi a-helix 0 .8 0 .8 hsV4 ARD R232C Avi hsV4 ARD R232C Avi 0 .7 0 .7 hsV4 ARD K276E Avi hsV4 ARD K276E Avi 0 .6 0 .6 40 biotinylated 40 0 .5 0 .5 0 .4 0 .4 0 .3 0 .3 0 .2 0 .2 20 20 0 .1 0 .1 0 .0 0 .0 N wt D D t V4 D R 2C R 6E 4 N w RD C RD EA hs R 3 A 7 A s V RD A 32 A 76 R2 K2 h A R2 K2 0 0 -20 -20 -40 -40 200 210 220 230 240 250 260 200 210 220 230 240 250 260 l [nm] l [nm] 86 Abs [mAu] 2 -1 280nm-3 q [10 deg cm dmol ] mrw, l sec. structure content -3 2 -1 Abs [mAu] 280nm q [10 deg cm dmol ] mrw, l sec. structure content Chapter 4. Results fold content compared to non-biotinylated hsV4N wt Avi. 4.1.2 The TRPV4 N-terminal protein interactome in HEK293 cells derived via mass spectrometry For the elucidation of the TRPV4 N-terminal protein interactome, biotinylated and non-biotinylated constructs (see subsection 4.1.1) were subjected to streptavidin-dependent pulldowns with HEK293 cytosolic extracts. Table 4.1 lists all samples which were used in the pulldowns with HEK293 cytosolic protein extracts (see figure 4.2 for workflow and section 3.8 for protocol). Shortly, streptavidin-coated magnetic beads were incubated with the respective purified TRPV4 N-terminal construct (biotinylated or non-biotinylated), washed and then incubated with the cy- tosolic extract of HEK293 cells. Additionally, samples with biotinylated constructs were sup- plemented with 2 mM Ca2+ during the HEK293 cytosolic extract incubation step to mimic an increased intracellular Ca2+ concentration as it would be observed upon TRPV4 ion channel activation. Table 4.1: Sample overview of hsV4N interactome pulldowns with HEK293 cytosolic protein extracts Construct Biotinylated Sample supplement hsV4N wt Avi Yes none hsV4 ARD wt Avi Yes none hsV4 ARD R232C Avi Yes none hsV4 ARD K276E Avi Yes none hsV4N wt Avi Yes 2 mM Ca2+ hsV4 ARD wt Avi Yes 2 mM Ca2+ hsV4 ARD R232C Avi Yes 2 mM Ca2+ hsV4 ARD K276E Avi Yes 2 mM Ca2+ Controls hsV4N wt Avi No none hsV4 ARD wt Avi No none hsV4 ARD R232C Avi No none hsV4 ARD K276E Avi No none 87 Chapter 4. Results Extracting cytosolic proteins Streptavidin-Biotin Pulldown Shotgun proteomics A HEK293 cells B C putative interactors interactor trypsin digestion Streptavidin bait tetramer (e.g. hsV4N wt Avi) peptides Digitonin extraction UPLC + = biotin ESI E back- UDMS + ground DIA = putative magnetic interactor bead m/z Figure 4.2: Outline of the proteomics workflow performed in this work. See sections 3.8 and 3.9 for protocols. A To enrich cytosolic proteins, plasma membranes of HEK293 cells were permebealized with digitonin. This detergent releases cytosolic proteins into the supernatant while contaminations by other cell compartments are reduced to a minimum.83 B Schematic layout of the hsV4N interactome pulldown. Streptavidin-bound magnetic beads were loaded with respective purified hsV4N Avi construct (see also figure 4.1). Loaded beads were incubated in HEK293 protein extract containing cytosolic proteins. As a control, beads were also incubated with non-biotinylated TRPV4 N-terminal constructs to rule out unspecific interactors (background).C After elution, putative interactors were trypsin digested to peptides. These peptides were then separated by ultra high-performance liquid chromatography (UPLC) and directly supplied into the mass spectrometer via electron spray ionization (ESI). MS data were collected in data independent acquisition (DIA) mode. All steps in C were performed in cooperation with University Medicine Mainz).63,72,73 The HEK293 protein interactome of the TRPV4 full-length N-terminus Figure 4.3 shows the volcano plots of two independent ultra high-definition mass spectrometryE (UDMSE) measurements of hsV4N wt Avi. In these volcano plots, only significantly detected proteins are shown. All samples listed in table 4.1 were measured in technical quadruplicates. Proteins were considered as significant, if the p-value was ≤ 0.05 (Benjamini-Hochberg cor- rected Student’s t-test) and the log2 fold change fo respective protein between biotinylated hsV4N wt Avi and non-biotinylated hsV4N Avi wt control sample was ≥ 1. Additionally, only pro- teins which appeared in both independent UDMSE measurements were considered as highly probable hsV4N wt Avi protein interactome members. Significant proteins showed different fold changes between the two independent measurements (black and grey dots in figure 4.3), in- dicating a high sensitivity of the UDMSE measurements towards different NaCl concentrations 88 Chapter 4. Results A B 12 12 2+ + 2 mM Ca 11 11 10 10 9 hsV4N wt Avi 9 8 8 hsV4N wt Avi 7 hsV4N wt Avi 7 6 6 5 5 4 4 hsV4N wt Avi 3 3 2 2 1 1 0 0 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 log2 fold change (biotinylated/non-biotinylated) log2 fold change (biotinylated/non-biotinylated) Figure 4.3: UDMSE measurements revealed up to 64 probable hsV4N protein interactors. A Volcano plot of two independent HEK293 protein interactome UDMSE measurements from hsV4N wt Avi. 34 proteins were considered as significant. B Volcano plot of two independent HEK293 protein interactome UDMSE measurements from hsV4N wt Avi with 2 mM Ca2+ sample supple- mentation. 64 proteins were considered as significant. Black (hsV4N wt Avi, 300 mM NaCl buffer) and dark gray points (hsV4N wt Avi, 750 mM NaCl buffer) indicate significant, detected HEK293 protein interactome candidates in both independent experiments. Each pulldown was measured in quadruplicates. Horizontal light gray lines indicate the p-value = 0.05 (Benjamini-Hochberg cor- rected Student’s t-test) of the quadruplicates of each UDMSE measurement. Vertical light gray lines indicate a log2 fold change ≥ 1. For a full list of hsV4N interactors, see tables 6.3 and 6.4 supplemented in the hsV4N wt Avi SEC buffer. Data analysis resulted in 34 relevant hsV4N wt Avi interaction partners in samples without Ca2+ supplementation and 64 hsV4N wt Avi interac- tion partners in the samples with Ca2+ supplementation (see figures 4.4 A and 4.5 A), including the known direct TRPV4 interactor PACSIN3 in both conditions.22,23,70,71 Gene Ontology enrich- ment analysis (GO enrichment analysis) is a technique to interpret high-throughput data in terms of over- or underrepresentation of certain genes in respective experiment. The Gene Ontology classification assigns genes to sets of predefined bins depending on their role in cellular pro- cesses or functional characteristics.97 GO enrichment analysis with STRING98 via Cytoscape 3.8.0 demonstrated that all detected proteins are associated with the cytoplasm, which is com- posed out of the cytosol and cytoskeleton, indicating successful extraction of mainly cytosolic proteins. Only HNRNPM_HUMAN represents an exception, as it is associated with the nucleo- plasm but also with ribonucleoprotein complexes - like the majority of the cytosolic proteins in the here disclosed network. Like HNRNPM_HUMAN, a small portion of other proteins could also be associated with the nucleoplasm, but are known for their nucleocytoplasmic shuttling.99 Ad- ditionally, GO enrichment analysis and manual data curation connected a considerable amount of detected proteins with cytoplasmic ribonucleoprotein or cytoplasmic stress granules (13 pro- teins, see figure 4.4 and table 6.3). Cytoplasmic ribonucleoprotein granule is a collective GO term for distinct RNA-binding protein-containing foci in the cytoplasm, including amongst others neuronal transport granules, P-bodies and stress granules. Stress granules, appearing as their name says after various stress factors like oxidative or hyperosmotic stress in the cytosol, form 89 -log10 (p-value) -log10 (p-value) Chapter 4. Results via liquid-liquid phase separation of pre-existing RNA-binding protein (RBP) complexes.100,101 The exact role of stress granules in neuronal (patho)physiological processes remains largely unknown. It is known that stress granule formation is accompanied by polysome disassembly and translational arrest.102–105 Stress granules are mostly composed out of translation initia- tors, RBPs, 40S ribosomes and polyadenylated mRNAs and therefore are proposed to play a protective role in cells by promptly providing the undamaged translation machinery for important household proteins after their disassembly due to stress withdrawal.106–110 Stress granules and other cytoplasmic ribonucleoprotein granules show major overlaps in their proteome but are also known for their highly variable and dynamic protein compositions, transitioning from one granule to the other in dependency of the cellular stress level.101,107–109,111–114 Liu-Yesucevitz et al. showed that potassium chloride (KCl)-induced depolarization in primary neurons, leading to dramatically elevated cytoplasmic Ca2+ levels, induces a transformation of neuronal mRNA transport granules to stress granules.115 Interestingly, it was shown that neuropathy-causing mutations of TRPV4 show an elevated baseline Ca2+-influx activity of the channel, also leading to higher cytosolic Ca2+-concentrations.53,54 In the present work, upon Ca2+-supplementation, the amount of ribosomal proteins in the hsV4N interactome considerably increased, but also the number of proteins associated with cytosolic ribonucleoprotein granules (20 proteins, figure 4.5 and table 6.4). In both conditions, without and with Ca2+, known stress granule formation proteins are present, namely YBX1, IGF2BP1, PAPBC1 and DDX3X.107,108,116–120 Furthermore, upon Ca2+ supplementation proteins associated with the GO term supramolecular fiber were detected. Supramolecular fibers are defined as protein complexes which form fiber-shaped structures, like microtubule or actin filaments. Fiber-like structures were shown to spur the mat- uration of phase-seperated droplets to more stable and less dynamic structures and therefore impair an important property of stress granules: the fast disassembly within minutes after stress removal.101,102,117,121–130 Amyotrophic lateral sclerosis (ALS)-causing mutations in stress gran- ule proteins, especially in the intrinsically disordered regions (IDRs) of RBPs, were shown in cellulo to lead to insoluble inclusions. This is particularly interesting, as the TRPV4-associated neuropathy Charcot-Marie-Tooth Type 2C is also referred as a so-called "ALS-mimic", due to the shared clinical symptoms.131 Furthermore, insoluble inclusion formations were also observed Figure 4.4 (facing page): The hsV4N protein interactome determined via UDMSE. A STRING interaction network of detected, significant hsV4N interactome proteins. Outer ring color of nodes represent Gene Ontology (GO) terms for cell components, also shown in B. For a full list of protein interactors see table 6.3 B Selected GO terms for cell components of significant, detected hsV4N interactome proteins via UDMSE after GO enrichment analysis. C Selected GO terms for cell processes of significantly detected hsV4N interactome proteins via UDMSE after GO enrichment analysis (Benjamini-Hochberg corrected, p<0.05) 90 Chapter 4. Results RNP granules/ A stress granules B ribonucleoprotein complex ribosome cytoplasmic ribonucleo- protein granule CRD-mediated mRNA stability complex nucleoplasm cytoplasm cytoplasmic stress granule 0 5 10 15 20 25 30 35 40 C -log10 (p-value) mRNA metabolic process translational initiation nuclear-transcribed mRNA nonsense-mediated decay nuclear-transcribed mRNA catabolic process gene expression SRP-dependent cotranslational protein targeting to membrane protein localization to organelle translation, negative regulation of peptide metabolic process cellular protein localization establishment of protein localization to organelle cellular localization negative regulation of macro- molecule metabolic process macromolecule localization RNA processing 0 5 10 15 20 25 30 35 40 45 50 -log10 (p-value) 91 Chapter 4. Results with wild-typic RBPs after induction of repeated cycles of stress granule assembly and disas- sembly in short time, mimicking chronic stress conditions.100,132 Permanent Ca2+ influx, for example via neuropathy-causing mutations in TRPV4, could thus lead to a pathological switch from dynamic granules to aggregates, which then impair the important roles of ribonucleopro- tein granule functions like dendritic and axonal mRNA transport and local translation. Due to the unique cellular structure of neurons, this cell type is more sensitive to the lacking clearance of these aggregates and therefore explain the high neurotoxicity of these inclusions.133–135 Thus, TRPV4 and its disease-causing mutations provide multiple factors to be a part of the stress granule machinery. Neuropathy causing TRPV4 mutations, like TRPV4 R232C, lead to chronic stress levels due to increased Ca2+-influx activity. Based on the data shown here, hsV4N itself could act as a direct interaction site for stress granule key proteins and in combination with the Ca2+-dependent recruitment of proteins involved in supramolecular fiber formation, possibly leading to neurotoxic aggregates. To narrow down the interaction sites of the previously identified hsV4N interactors, several hsV4 ARD constructs were probed in the same UDMSE experimental set-ups as hsV4N. The ARD of TRPV4 is a hot-spot for disease-causing mutations.27,56 Here, besides the wild-typic hsV4 ARD, hsV4 ARD harboring the neuropathy-causing R232C mutation as well as the fetal-akinesia causing hsV4 ARD K276E mutation were investigated with regard to their HEK293 cells protein interactome. Figures 4.6 A-F show the STRING interaction map and GO enrichment analysis of the respective hsV4 ARD construct without and with Ca2+-supplementation. To provide a better overview, only proteins associated with ribonucleoprotein granules and/or stress granules via GO analysis and/or manual data curation are shown in the interaction maps (figures 4.6 A-E). Upon Ca2+-supplementation, the amount of RBPs increases in the case of hsV4 ARD wt (fig- ures 4.6 A and B) and R232C (figures 4.6 C and D). Only for hsV4 ARD K276E the amount of riboluceoprotein granule associated proteins decreases upon Ca2+-supplementation (figure 4.6 E and F). It should be noted that TRPV4 R232C showed elevated basal Ca2+-influx level in cellulo.53,54 Basal Ca2+-influx activities of TRPV4 K276E were not evaluated until now, but due to the severe clinical outcome of this mutation it could be assumed that this mutation also leads to a gain-of-function phenotype of the channel.48 It is therefore possible that the interactions after Ca2+ supplementation are more representative for the possible aberrant PPIs in the pres- ence of disease-causing mutations (figures 4.6 C and D (hsV4 ARD R232C) as well as E and F (hsV4 ARD K276E), respectively). Comparing the interactome composition between the different TRPV4 N-terminal constructs, it seems that the interactome is highly variable - not only between the samples without and with 92 Chapter 4. Results Ca2+-supplementation, but also between hsV4 ARD wt and mutated hsV4 ARDs, as well as between hsV4N and hsV4 ARD wt (see figure 4.7). These variations could thus hint towards an important regulatory role of the intrinsically disordered region (hsV4 IDR), preceding hsV4 ARD in hsV4N, on the protein interactions of hsV4 ARD. Interestingly, throughout all UDMSE measurements, the ATP-dependent RNA-helicase DDX3X was detected as a part of the hsV4N protein interactome, more precisely of hsV4 ARD protein interactome. DDX3X was shown to directly interact with full-length TRPV4 via a yeast-two hybrid screening (Y2H), although the species of used TRPV4 was not mentioned in the publication.136 Due to the central role of DDX3X in stress granule formation and its role in neurodegeneration, section 4.2 gives a closer look on the probable direct interaction between DDX3X and hsV4N.119,137–139 The TRIP database (http://trpchannel.org/) is a manually curated database of PPIs for mam- malian TRP channels and therefore gives an overview of known PPIs of TRPV4.16,29,30 Most of the listed interactors in the TRIP database were determined via co-immunoprecipitations (co-IPs), co-immunofluorescence staining and/or FRET measurements with endogenous pro- teins and/or overexpressing HEK293 cells (see also table 6.1). The TRPV4 interacting protein classes which are represented in the TRIP databsae are very diverse, including amongst others, transmembrane proteins (TRPC1, AT1aR, AQP4 e.g.), kinases (FYN, LYN e.g.), E3 ubiquitin ligases (ITCH) and cytoskeletal proteins (α-actin and α-tubulins). Another reliable database for PPIs is BioGrid (https://thebiogrid.org/). BioGrid lists the same protein interactors as the TRIP database for human TRPV4.140 In both databases, no RBPs or other proteins involved in cyto- plasmic ribonucleoprotein granules are indicated. One reason for this could be that most of the PPI determinations were conducted via co-IPs of full-length TRPV4 and subsequent western blotting with immunostaining, only allowing to investigate pin-pointed PPIs with certain proteins. Comprehensive mass spectrometric proteomics analysis of isolated TRPV4 domains like the here used hsV4N as a bait were not published until now. Donate-Macian et al. used full-length TRPV4 as a bait for Y2H screening of direct TRPV4 interactors, the species of the used TRPV4 construct was not mentioned though, as pointed out above. Besides DDX3X, UBAP2L was also shown to directly interact with TRPV4.136 In this thesis, UBAP2L was detected in UDSME Figure 4.5 (facing page): The hsV4N wt Avi protein interactome determined via UDMSE with Ca2+ sample supplementation. A STRING interaction network of detected, significant hsV4N interactome proteins. Outer ring color of nodes represent Gene Ontology (GO) terms for cell components, also shown in B. For a full list of protein interactors see table 6.4 B Selected GO terms for cell components of significant, detected hsV4N wt Avi interactome proteins via UDMSE after GO enrichment analysis. C Selected GO terms for cell processes of significant, detected hsV4N interactome proteins via UDMSE after GO enrichment analysis. 93 Chapter 4. Results RNP granules/ stress granules A B ribonucleoprotein complex ribosome cytoplasm cytoplasmic ribonucleo- protein granule CRD-mediated mRNA stability complex cytoplasmic stress granule nucleoplasm supramolecular fiber 0 5 10 15 20 25 30 35 40 C -log10 (p-value) nuclear-transcribed mRNA nonsense-mediated decay SRP-dependent cotranslational protein targeting to membrane translational initiation nuclear-transcribed mRNA catabolic process mRNA metabolic process translation nucleobase-containing compound catabolic process peptide metabolic process protein localization to organelle establishment of protein localization to organelle negative regulation of gene expression intracellular protein transport cellular protein localization negative regulation of macro- molecule metabolic process cellular localization 0 5 10 15 20 25 30 35 40 45 50 -log10 (p-value) 94 Chapter 4. Results experiments conducted with hsV4 ARD wt (figures 4.6 A and B). However, the protein over- lap between UDSME and Y2H is low, which was also already shown after comparison of other affinity purification MS (AP-MS) experiments with Y2H screens with the same bait protein. This emphasizes the highly complementary nature of both techniques: while MS approaches provide large-scale data on protein complexes, with additional Y2H results it is possible to break these complexes down into binary PPIs.141 2+ A B + 2 mM Ca A C R A D C R2 2 D 23 K 3 R A 2 2 K v 7 R i A 27 D vi i 6 R A E D v v 6 R A i E A A 2 79 h 5 34s hV t s t 4 V w A N w 4 7 v D i 5 A N D R i 1 9 i w R v 9 v v t A 6A i w t A A 2 1 7 1 21 22 50 33 13 2 0 20 8 1 1 0 3 5 0 5 Figure 4.7: Venn diagrams of overlapping proteins detected in respective UDMSE experiments without (A) and with Ca2+ sample supplementation (B). For full lists of detected proteins see tables 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9 and 6.10 Figure 4.6 (facing page): Interaction map, volcano plots and enrichment analysis of Gene Ontology (GO) cell component and processes terms of hsV4 ARD wt Avi, hsV4 ARD R232C Avi and hsV4 ARD K276E Avi interactome proteins detected via UDMSE without (A,C,E) and with Ca2+ sample supplementation (B,D,F) For full lists of protein interactors see tables 6.5, 6.6, 6.7, 6.8, 6.9 and 6.10 A hsV4 ARD wt Avi Upper left: STRING interaction network of detected, significant hsV4 ARD wt Avi interactome proteins associated with cytoplasmic ribonucleoprotein granules and/or stress granules after manual data curation. For full list of interactors see section 6.3. Outer ring color of nodes represent GO cell component terms shown in the GO cell component enrichment graphic below. Upper right: Volcano plot of two independent HEK293 protein interactome UDMSE experiments with hsV4 ARD wt Avi. Each pulldown was measured in quadruplicates. Horizontal light gray line indicates p-value = 0.05 (Benjamini- Hochberg corrected Student’s t-test). Vertical light gray line indicates log2 fold change ≥ 1. Lower left: Selected GO terms for cell components of significant, detected hsV4 ARD wt Avi interactome proteins via UDMSE after GO enrichment analysis (Benjamini- Hochberg corrected, p<0.05). Lower Right: Top 15 GO cell processes terms of significant, detected hsV4 ARD wt Avi interactome proteins via UDMSE after GO enrichment analysis (Benjamini-Hochberg corrected, p < 0.05). B hsV4 ARD wt Avi with Ca2+. C hsV4 ARD R232C Avi and D with Ca2+. E hsV4 ARD K276 Avi and F with Ca2+. Please note for graphs in E and F the range changing in the x-axis of the GO Enrichment Processes Graphs in comparison to A-D. 95 Chapter 4. Results A 25 20 15 10 5 hsV4 ARD wt Avi 0 0 5 10 15 20 log2 fold change (biotinylated/non-biotinylated) RNA binding ribonucleoprotein complex mRNA binding mRNA 5’-UTR binding cytoplasm N6-methyladenosine- containing RNA binding mRNA 3’-UTR binding nucleoplasm structural constituent of ribosome organic cyclic compound binding heterocyclic compound binding ubiquitin ligase inhibitor activity 5S rRNA binding rRNA binding Tat protein binding G-rich strand telomeric DNA binding structural molecule activity ubiquitin protein ligase binding 0 5 10 15 20 25 0 5 10 15 20 25 -log10 (p-value) -log10 (p-value) B 25 2+ + 2 mM Ca 20 15 10 hsV4 ARD wt Avi 5 0 0 5 10 15 20 log2 fold change (biotinylated/non-biotinylated) structural constituent ribonucleoprotein of ribosome complex RNA binding structural molecule activity ribosome unfolded protein binding mRNA binding cytoplasm rRNA binding heterocyclic compound binding cytoplasmic organic cyclic ribonucleoprotein compound binding granule single-stranded RNA binding mRNA 5’-UTR binding cytoplasmic poly(A) binding stress granule translation regulator activity nucleoplasm poly-pyrimidine tract binding nucleic acid binding supramolecular protein folding chaperone fiber nucleotide binding 0 5 10 15 20 25 0 5 10 15 20 25 -log10 (p-value) -log10 (p-value) 96 -log10 (p-value) -log10 (p-value) Chapter 4. Results C 25 20 15 hsV4 ARD R232C Avi 10 5 0 0 5 10 15 20 log2 fold change (biotinylated/non-biotinylated) mRNA metabolic process ribonucleoprotein negative regulation complex of gene expression nuclear-transcribed mRNA catabolic process nucleoplasm translational initiation SRP-dependent cotranslational cytoplasmic protein targeting to membrane ribonucleoprotein intracellular protein transport granule cellular protein localization peptide transport ribosome biogenesis organic cyclic compound catabolic process regulation of gene expression peptide metabolic process RNA processing negative regulation of biological process RNA metabolic process 0 5 10 15 20 25 0 5 10 15 20 25 -log10 (p-value) -log10 (p-value) 25 D 2++ 2 mM Ca 20 15 10 hsV4 ARD R232C Avi 5 0 0 5 10 15 20 log2 fold change (biotinylated/non-biotinylated) structural constituent ribonucleoprotein of ribosome complex RNA binding mRNA binding nucleoplasm rRNA binding cytoplasmic 5S rRNA binding ribonucleoprotein mRNA 5’-UTR binding granule ATP-dependent helicase activity cytoplasm nucleic acid binding pre-mRNA binding ubiquitin ligase inhibitor activity heterocyclic compound binding organic cyclic compound binding G-rich strand telomeric DNA binding ATP-dependent RNA helicase activity single-stranded RNA binding 0 5 10 15 20 25 0 5 10 15 20 25 -log10 (p-value) -log10 (p-value) 97 -log10 (p-value) -log10 (p-value) Chapter 4. Results E 25 20 15 10 5 hsV4 ARD K276E Avi 0 0 5 10 15 20 log2 fold change (biotinylated/non-biotinylated) SRP-dependent cotranslational ribonucleoprotein 46,3 protein targeting to membrane complex mRNA metabolic process translational initiation ribosome 33,5 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay mRNA catabolic process cytoplasm nuclear-transcribed mRNA catabolic process protein targeting cytoplasmic ribonucleoprotein translation granule nucleobase-containing compound catabolic process amide biosynthetic process nucleoplasm peptide metabolic process establishment of protein localization cytoplasmic to organelle stress granule intracellular protein transport protein localization to organelle negative regulation of gene expression 0 5 10 15 20 25 30 35 40 45 50 55 60 65 0 5 10 15 20 25 -log -log10 (p-value)10 (p-value) F 25 2+ + 2 mM Ca 20 15 hsV4 ARD K276E Avi 10 5 0 0 5 10 15 20 log2 fold change (biotinylated/non-biotinylated) translational initiation ribonucleoprotein 42,3 complex SRP-dependent cotranslational protein targeting to membrane mRNA metabolic process ribosome 26,2 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay nuclear-transcribed mRNA cytoplasm catabolic process translation RNA catabolic process cytoplasmic ribonucleoprotein nucleobase-containing compound catabolic process granule amide biosynthetic process nucleoplasm peptide metabolic process cellular amide metabolic process cytoplasmic protein localization to organelle stress granule establishment of protein localization to organelle cellular protein localization intracellular protein transport 0 5 10 15 20 25 0 5 10 15 20 25 30 35 40 45 50 55 60 65 -log10 (p-value) -log10 (p-value) 98 -log10 (p-value) -log10 (p-value) Chapter 4. Results The UDMSE interactome results shown in this thesis revealed ribonucleotide binding proteins as a new potential class of TRPV4 interacting proteins and thus indicate TRPV4 as a until now unknown player in the regulatory mechanism of cytoplasmic ribonulceoprotein granule formation via its cytosolic N-terminus. The following sections take a closer look on chosen TRPV4 PPIs in vitro and in cellulo. 99 Chapter 4. Results 4.2 Birds of a feather flock together - the interaction between the two protean proteins TRPV4 and DDX3X As described in sub chapter 4.1, elaborate mass spectrometry (MS)-based interactome stud- ies of hsV4N showed a significant amount of RNA-binding proteins (RBPs) as a new class of potential TRPV4 binding partners. The composition of detected RBPs varied between different conditions, like the presence of disease-causing mutations and/or Ca2+-supplementation. In- triguingly, the ATP-dependent RNA-helicase DDX3X was consistently detected in all samples. Recently, Donate-Macian et al.136 showed via a Y2H screening that DDX3X is a direct interactor of full-length TRPV4. The MS-based interactome studies conducted in this work indicate that DDX3X possibly binds to the TRPV4 N-terminus with the ARD (hsV4 ARD) as a minimal bind- ing site. Log2 ratios of DDX3X in respective MS-measurements already suggested elevated DDX3X binding-levels with mutation-bearing hsV4 ARDs (hsV4 ARD R232C and K276E, re- spectively) in comparison to hsV4 ARD wt or hsV4N (see tables 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9 and 6.10). To conduct in vitro experiments regarding the probable direct interaction between DDX3X and hsV4 ARD, recombinant DDX3X and TRPV4 N-terminal constructs were purified and their structural integrity confirmed as shown in figure 4.8 (see subsections 3.7.1 and 3.7.6 for purification protocols). hsV4 ARD K276E showed heavy precipitation behavior in all sub- sequent in vitro studies and is therefore not shown in following procedures and experiments. Figure 4.8 (facing page): Purification of recombinant human TRPV4 N-terminal constructs and human DDX3X. A Topol- ogy model of recombinantly expressed human TRPV4 N-terminal constructs and human DDX3X. The DDX3X construct was optimized for future nuclear magnetic resonance spectroscopy experiments, comprising supposedly unstructured regions which include residues aa 1 - 120 and aa 582 - 662. His6 = hexa-histidine tag (single letter code: HHHHHH), TEV = Tobacco Etch Virus Cleavage Site (single letter code: ENLYFQG), DEAD = DEAD domain (RecA-like domain 1), HELICc = C-terminal helicase domain (RecA-like domain 2). See figure 4.14 A for full-length DDX3X. His6-tags with preceding or subsequent TEV Cleveage Site were removed. B SEC purifications of human TRPV4 N-terminal constructs and human DDX3X. SEC runs were performed with either a HiLoad Superdex 200 or a HiLoad Superdex 75 pg preparative SEC column. Inlets show Coomassie stained 15 % SDS-PAGEs of collected and concentrated fractions after SEC. x-axis: eluted volume in mL, y-axis: absorbance at 280 nm, M = marker. C Comparison of far UV CD spectra of purified human TRPV4 N-terminal constructs and human DDX3X, respectively. Spectra were measured at 293 K and proteins were used at 1µM concentration in either SEC Buffer with a final NaCl concentration of 30 mM (TRPV4 N-terminal constructs) or DDX3X SEC buffer with a final concentration of 12.5 mM NaCl (DDX3X). Inlets show secondary structure prediction performed with CAPITO.93 The predicted α-helix/β-sheet/random coil content of the purified proteins is for hsV4N 53 %/0 %/47 %, hsV4N R232C 33 %/13 %/53 %, hsV4 ARD wt 68 %/0 %/32 %, hsV4 ARD R232C 78 %/0 %/32 % and DDX3X 40 %/14 %/46 %. y-axis: mean residue ellipticity ([Θ]mrw,λ) in 10−3 deg cm2 dmol−1, x-axis: wavelength λ in nm. 100 Chapter 4. Results A 1 149 398 hsV4N wt N PDB PRR ARD His 1 6 C R232C hsV4N R232C N PDB PRR ARD His6 C hsV4 ARD wt N ARD His6 C R232C hsV4 ARD 232C N ARD His6 C hsV4 IDR N PDB PRR TEV His6 C 121 182 404 414 544 581 DDX3X N His6 TEV DEAD HelicC C B MW MW Coomassie [kDa] 200 hsV4N 350 [kDa] Coomassie hsV4 ARD wt 75 hsV4N R232C 75 hsV4 ARD R232C DDX3X 75 50 300 50 50 37 37 3X N 4N 37150 DX sV4 sV CD h h 232R 250 25 25 25 wt 32 C 200 R2 100 hsV4 ARD 150 100 50 50 Superdex200 Superdex75 0 0 40 50 60 70 80 90 100 40 50 60 70 80 90 100 Volume [mL] Volume [mL] C 1 .0 random coil 1 .0 random coil b-sheet b-sheet 60 hsV4N 0 .9 a-helix 60 DDX3X 0 .9 a-helix hsV4N R232C 0 .8 0 .8 hsV4 ARD wt 0 .7 0 .7 hsV4 ARD R232C 0 .6 0 .6 40 40 0 .5 0 .5 0 .4 0 .4 0 .3 0 .3 20 0 .2 20 0 .2 0 .1 0 .1 0 .0 0 .0 4N 4N RDV V A AR D X s C t 2 C h hs 2 w 3 DX 3 R2 3 R2 D 0 0 -20 -20 -40 -40 200 210 220 230 240 250 260 200 210 220 230 240 250 260 l [nm] l [nm] 101 3 2 -1 Abs [mAu] q [10 deg cm dmol ] 280nm mrw, l sec. structure content 3 2 -1 q [10 deg cm dmol ] mrw, l Abs [mAu] 280nm sec. structure content Chapter 4. Results A B 1,2 DDX3X w/o dxRNA 35 DDX3X DDX3X w/o dxRNA DDX3X 30 DDX3X : hsV4N 1:4 1,0 DDX3X : hsV4 ARD wt 1:4 25 DDX3X : hsV4 IDR 1:4 0,8 20 0,6 15 0,4 10 0,2 5 0,0 0 0 400 800 1200 1600 2000 2400 2800 3200 3600 C D 1,2 DDX3X 1,2 DDX3X DDX3X : hsV4N 1:4 DDX3X : hsV4 ARD wt 1:4 DDX3X : IDR 1:4 1,0 1,0 0,8 0,8 0,6 0,6 0,4 0,4 0,2 0,2 0,0 0,0 0 400 800 1200 1600 2000 2400 2800 3200 3600 0 400 800 1200 1600 2000 2400 2800 3200 3600 time [sec] time [sec] Figure 4.9: hsV4 ARD, but not hsV4N, decreases the DDX3X ATPase activity. A In an enzyme-coupled ATPase assay, DDX3X showed a time-dependent duplex RNA (dxRNA)-stimulated ATPase activity (black) and a negligible ATPase activity in the absence of dxRNA (DDX3X w/o dxRNA, dark gray), in agreement with the literature.84,142 B DDX3X ATPase activity in the presence of several TRPV4 N-terminal constructs. Error bars indicate SDs of determined slopes after natural logarithmic conversion and linear regression. C+D DDX3X showed decreased ATPase activity in the presence of hsV4 ARD. Interestingly, hsV4N itself and the ARD preceding intrinsically disordered region (IDR) consisting of amino acids 1-149 of hsV4N do not demonstrate such an effect on DDX3X. DDX3X was used at a concentration of 3µM and TRPV4 N-terminal constructs at 12µM, resulting in a 1:4 ratio. After 30 s samples were supplemented with ATP and after 5 min with duplex RNA (dxRNA), both at a final concentration of 1µM. ATPase activity was determined by an ATP-dependent enzyme-coupled oxidation from NADH to NAD+, resulting in an time-dependent absorption decrease at 340 nm. Measurements were normalized to DDX3X ATPase activity. Error bars indicate SDs of three measurements of three independent DDX3X purifications for each condition. Used TRPV4 N-terminal constructs originated from one purification. x-axis = time in s, y-axis = extinction at 340 nm in arbitrary units. IDR was kindly provided and fully characterized by Dr. and .143 To ensure enzymatic activity of purified DDX3X, an enzyme-coupled ATPase assay was per- formed (see figures 4.13 C and D). In agreement with Epling et al.142, DDX3X showed a time- dependent duplex RNA (dxRNA)-stimulated ATPase activity and a negligible ATPase activity in the absence of dxRNA (figure 4.9 A). When supplemented with hsV4 ARD, the ATPase activity of DDX3X significantly decreased, whereas no effect was observed upon hsV4N supplemen- tation (see figure 4.9). Interestingly, DDX3X ATPase activity did not decrease in the presence 102 Norm. extinction [a.u.] Norm. extinction [a.u.] -1 -1 pmol*sec *µg Chapter 4. Results of the isolated TRPV4 intrinsic disordered region (hsV4 IDR), which consists of aa 1-149 of hsV4N, preceding the hsV4 ARD. As a control, the well-characterized B. subtilis ATPase BmrA was also supplemented with hsV4 ARD to rule out unspecific effects on the lactate dehydro- genase and pyruvate kinase involved in this assay. No decrease in BmrA ATPase activity was observed upon hsV4 ARD wt supplementation (see section 6.4, figure 6.3), supporting the di- rect interaction between hsV4 ARD and DDX3X. Nevertheless the question arose, why there is such a discrepancy between hsV4N and hsV4 ARD modulation of DDX3X ATPase activ- ity. Cross-linking mass spectrometry (XL-MS) experiments with DSS-cross linked hsV4N and DDX3X (see figure 4.10) revealed cross-linking between K251 of hsV4 ARD and K511 in the C-terminal helicase domain (HelicC) of DDX3X in close proximity to motifs V (aa 501-505) and VI (aa 525-536), which are responsible for RNA recognition (motif V) and ATP-binding (motif VI).144 121 182 404 414 544 581 DDX3X N His TEV DEAD HelicC C6 = lysine residue 1 149 398 hsV4N wt N PDB PRR ARD His6 C Figure 4.10: Cross-linking mass spectrometry (XL-MS) confirms a direct interaction between hsV4N and DDX3X. Green bars indicate native lysine residues, whereas lysine residues involved in DSS-mediated cross-linking are additionally numbered. Black lines show cross-links including hsV4N K70 and DDX3X lysine residues, red lines cross-links between hsV4N K121 and DDX3X K491 and hsV4N K251 and DDX3X K511, respectively. XL-MS measurements were kindly carried out by M.Sc. University of Konstanz) XL-MS experiments of Dr. Benedikt Goretzki demonstrated an IDR-ARD interaction in the G. gallus (chicken) TRPV4 N-terminus (ggV4N) between distinct lysine residues, indicating these interactions not to be arbitrary but rather following certain preferred contact sites of the IDR with the ARD.23 Amongst others, ggV4N showed an intra-domain interaction between K56IDR and K237ARD, which could be also detected in the corresponding lysine residues K70IDR and K251ARD in hsV4N (data not shown). It was previously shown that the TRPV4 N-termini of chicken and human share important conserved motifs like the prolines in the PRR and show overall similiar behavior and structural features (sharing 84.27 % amino acid identity), enabling to transfer in vitro studies of the N-termini between the species.22 Regarding this folding behav- ior of the IDR back to the ARD, preventing the ARD to interact with a distinct contact site with the DDX3X HelicC domain, the difference of ATPase activity modulation between hsV4N, IDR and hsV4 ARD could be explained. The interaction of the IDR itself seems not to play a role in 103 70 121 208 255 264 251 452 491 511 251 554 Chapter 4. Results ATPase modulation of DDX3X. Inada et al. showed that hsV4 ARD is able to bind ATP, which induces conformational changes in fingers 2 and 3.27 A B DDX3X 1800000 DDX3X 1800000 l = 346 nm DDX3X:ARD 1:1 DDX3X max DDX3X:ARD 1:4 DDX3X:ARD 1:11600000 1600000 lmax = 330 nm DDX3X:ARD 1:4 (± 1.7) l = 348 nm lmax = 347 nm max 1400000 (± 0.8) 1400000 1200000 1200000 lmax = 348 nm 1000000 (± 0.8) 1000000 800000 800000 l = 335 nm 600000 max 600000 (± 0.9) 400000 400000 200000 200000 lmax = 338 nm (± 0.9) 0 0 300 320 340 360 380 400 300 320 340 360 380 400 Emission l [nm] Emission l [nm] C 121 182 404 414 544 581 DDX3X N DEAD HelicC C = tryptophan Figure 4.11: hsV4 ARD interacts with duplex RNA (dxRNA)-bound DDX3X.A Tryptophan fluorescence measurements of DDX3X and hsV4 ARD wt. B Tryptophan fluorescence measurements of DDX3X and hsV4 ARD wt in the presence of dxRNA. Each sample was additionally supplemented with 1µM ATP, as DDX3X requires ATP for RNA binding.144 hsV4 ARD does not har- bor tryptophan residues. DDX3X was used at a concentration of 3µM and hsV4 ARD at either 3µM (1:1 ratio) or 12µM (1:4 ratio). Indicated samples were supplemented with duplex RNA (dxRNA) to a final concentration of 1µM. Measurements with dxRNA were corrected due to the inner filter effect of supplemented dxRNA (see equations 4.1 and 4.2).145 Error bars indicate SDs of three measurements of three independent DDX3X purifications for each condition. Used TRPV4 N-terminal constructs originated from one purification. Emission maxima (λmax in nm) are listed with SDs if applicable. x-axis = emission wavelength λ in nm, y-axis = fluorescence intensity in arbitrary units. C Topology model of recombinantly expressed and purified human DDX3X used for tryptophan fluoresence measurements, containing four tryptophan residues (indicated by pink bars). DEAD = DEAD domain (RecA-like domain 1), HELICc = C-terminal helicase domain (RecA-like domain 2). See figure 4.14 A for full-length DDX3X. To exlcude unspecific DDX3X ATPase activity modulation via interactions between the dxRNA phosphate groups and the basic surfaces of hsV4 ARD, tryptophan fluorescence measure- ments were carried out (figure 4.11). The DDX3X construct used here harbors four tryptophan residues (W127, W137, W421 and W570), whereas hsV4 ARD does not include any trypto- phan residues, resulting in the DDX3X tryptophan residues to be the only reporters in these measurements. With tryptophan fluorescence it is possible to investigate the polarity of tryp- tophan environments in proteins, displayed by the position of the tryptophan residue emission maxima. Polar environments result in redshifted emission maxima, hydrophobic environments therefore in blueshifted maxima. Furthermore, the quantum yield and thus the emission inten- sity also depends on the tryptophan’s direct environment, displaying higher emission intensities 104 Intensity [a.u.] 127 136 421 570 + dxRNA Chapter 4. Results of tryptophan residues in more apolar surroundings.145 Due to inner filter effects (quenching of tryptophan fluorescence) of the supplemented dxRNA, the obtained fluorescence spectra were corrected according to Hellmann et al. with the following equations:145 F (x) Correction Factor (CF) = W FW(0) (4.1) The Correction Factor (CF) in equation 4.1 is obtained by the division of the fluorescence of a tryptophane solution with 1 µM dxRNA (FW(x)) by the fluorescence of a pure tryptophane solution (FW(0)). The tryptophan concentration here was the same as used for DDX3X in the measurements (3 µM). The corrected tryptophan fluorescence for DDX3X (FDDX3X, corrected(x)) was then obtained by dividing the measured tryptophan fluorescence with dxRNA (FDDX3X(x)) divided by CF (see 4.2). FDDX3X(x)FDDX3X, corrected(x) = (4.2)CF The displayed tryptophan fluorescence measurements suggest that hsV4 ARD binds to ATP and dxRNA-bound DDX3X. Intensity changes in figure 4.11 A are not considered significant, as more measurements have to be carried out to receive statistical relevant results with DDX3X and hsV4 ARD in the ratios 1:1 and 1:4, respectively. Emission spectra in figure 4.11 B hint to a dxRNA mediated interaction between DDX3X and hsV4 ARD. Upon dxRNA addition, the emission maximum significantly blueshifted in comparison to ATP-bound DDX3X in the absence of dxRNA from 348 nm to 338 nm, which implies a considerable polarity change of the DDX3X tryptophan residues towards a more hydrophobic environment. The crystal structures shown in figure 4.12 visualize the dramatic structural change and therefore the tryptophane residues’ environmental change upon RNA binding in DDX3X.142,144 Addition of dxRNA lead to a sig- nificant emission intensity decrease, which can be explained by the quenching effect of RNA in tryptophane fluorescece measurements.146,147 Interestingly, upon hsV4 ARD supplementa- tion, the DDX3X emission maxima gradually redshifted, suggesting a direct interaction between DDX3X and hsV4 ARD. Additionally, a dramatic emission intensity increase upon hsV4 ARD supplementation was detected, especially at a DDX3X:hsV4 ARD ratio of 1:4. These trypto- phan residues environment changes indicate a direct hsV4 ARD interaction with DDX3X and not unspecific binding of dxRNA by hsV4 ARD. 105 Chapter 4. Results A DDX3X apo DDX3X pre-unwound dsRNA B W421 B W570 DEAD domain C B W570 N B B W136 W421 HelicC domain B W136 A A W421 W136 A N W570 A W421 C AW136 PDB: 6O5F A W570 PDB: 5E7I B 121 182 404 414 544 581 DDX3X N DEAD HelicC C = tryptophan Figure 4.12: dsRNA binding changes the tryptophan environment in DDX3X dramatically. A Crystal structures of human DDX3X in the apo state (left, PDB: 5E7I)142 and bound to double-stranded RNA (right, PDB: 6O5F )144. ATP-binding DEAD domain is colored in light blue, the c-terminal helicase domain (HelicC) in dark blue. B Topology model of recombinantly expressed and purified human DDX3X used for tryptophan fluoresence measurements, containing four tryptophan residues (indicated by pink bars). DEAD = DEAD domain (RecA-like domain 1), HELICc = C-terminal helicase domain (RecA-like domain 2). See figure 4.14 A for full-length DDX3X. XL-MS measurements were carried out without any ATP or dxRNA supplementation, as these additions could have interfered the cross-linking reaction, showing that the DDX3X:hsV4 ARD interaction also occurs without these components. One main advantage of XL-MS is the pos- sibility to capture PPIs, which are very weak and/or transient.87 Therefore, the XL-MS results combined with the rather low-resolution spectroscopic and photometric measurements indicate that DDX3X also interacts with hsV4 ARD in the apo state in vitro, but that this interaction can be enhanced upon ATP- and dxRNA binding. As DDX3X showed higher log2 ratios in MS- measurements carried out in subchapter 4.1 with hsV4 ARD R232C compared to hsV4 ARD wt or hsV4N, suggesting elevated DDX3X-binding level in the presence of this mutation, com- plementary ATPase assays as in figure 4.9 were carried out with respective mutation bearing TRPV4 N-terminal constructs. Interestingly, both hsV4N R232C and hsV4 ARD R232C showed significantly higher ATPase inhibiting effects as their wild-typic complementaries (figure 4.13). 106 127 136 421 570 Chapter 4. Results These results underline the trend that DDX3X ATPase activity inhibition by hsV4 ARD R232C is more enhanced than by hsV4N R232C. As Dr. Benedikt Goretzki suggested23, the charge distribution in ggV4N probably modulates the interaction between IDR and ARD. The very N- terminal part of ggV4N is enriched with negatively charged residues, which could interact with the overall positively charged residues of the ARD finger 1 and 2. Arg232 in hsV4 ARD resides in finger 2 and furthermore builds a salt bridge to Glu183 in finger 1, which was observed in the crystal structure of the isolated hsV4 ARD.27 The neutral mutation R232C could disrupt the overall basic patch in hsV4 ARD which might be required for the intra-domain IDR-ARD inter- action. Additionally, the disruption of the R232-E183 salt bridge could influence the dynamics of finger 1 and 2 of hsV4 ARD, leading to altered conformational hierarchies in the IDR-ARD interaction. Thus, the R232C mutation could lead to a decreased IDR-mediated masking of the probable DDX3X interaction site of hsV4 ARD. A B C DDX3X alone DDX3X alone DDX3X DDX3X : hsV4N 1:4 DDX3X : hsV4 ARD wt 1:4 DDX3X : hsV4N 1:4 DDX3X : hsV4N R232C 1:4 DDX3X : hsV4 ARD R232C 1:4 DDX3X : hsV4 ARD wt 1:4 DDX3X : IDR 1:4 DDX3X : IDR 1:4 DDX3X : hsV4N R232C 1:4 1,2 1,2 35 DDX3X : hsV4 ARD R232C 1:4 30 1,0 1,0 25 0,8 0,8 20 0,6 0,6 15 0,4 0,4 10 0,2 0,2 5 0,0 0,0 0 0 400 800 1200 1600 2000 2400 2800 3200 3600 0 400 800 1200 1600 2000 2400 2800 3200 3600 time [sec] time [sec] Figure 4.13: DDX3X ATPase activity inhibition is enhanced in the presence of neuropathy-causing TRPV4 R232C mutation. A + B An enzyme-coupled ATPase assay reveals an inhibitory effect of both, hsV4N R232C and hsV4 ARD R232C, onto the ATPase activity of DDX3X.84 DDX3X was used at a concentration of 3µM and TRPV4 N-terminal constructs at 12µM, resulting into a 1:4 ratio. After 30 s samples were supplemented with ATP and after 5 min with duplex RNA (dxRNA), both at a final concentration of 1µM. ATPase activity was determined by an ATP-dependent enzyme-coupled oxidation from NADH to NAD+, resulting in an time-dependent absorption decrease at 340 nm. Measurements were normalized to DDX3X ATPase activity (DDX3X). Error bars indicate SDs of three measurements of three independent DDX3X purifications for each condition. Used TRPV4 N-terminal constructs originated from one purification. The TRPV4 intrinsic disordered region (IDR), consisting of aa 1-149 preceding the ARD of hsV4N, was kindly provided and fully characterized by Dr. i23 and M. Sc. .143 x-axis = time in s, y-axis = extinction at 340 nm in arbitrary units C DDX3X ATPase activity in the presence of several TRPV4 N-terminal constructs. Error bars indicate SDs of determined slopes after natural logarithmic conversion and linear regression. Additionally to the Y2H screen showing direct interaction between the full-length TRPV4 chan- nel and DDX3X, Donate-Macian et al. performed co-IPs with full-length TRPV4 and DDX3X co-transfected in HEK293 cells. It was shown that DDX3X immunoprecipitates with TRPV4 and vice versa. To evaluate these in cellulo experiments, co-IPs were performed with HEK293T 107 Norm. extinction [a.u.] -1 -1 pmol*sec *µg Chapter 4. Results cells co-transfected with full length human TRPV4 with a c-terminal GFP-tag (hsTRPV4-cGFP) and full-length human DDX3X with a n-terminal V5-tag (hsDDX3X-nV5, see figure 4.14 A for a full-length DDX3X topology model of the here used construct compared to the recombinantly expressed and purified DDX3X used for the here shown in vitro experiments). Furthermore, to investigate the effects of TRPV4 disease-causing mutations on DDX3X interaction in cellulo, co-transfection and -IPs with hsTRPV4 R232C-cGFP and hsDDX3X-nV5 were also performed. Transfections with hsTRPV4 K276E-cGFP resulted in severe cell death (data not shown). Fig- ure 4.14 B and C show two western blots after co-IPs. Both western blots showed co-IP of hsDDX3X-nV5 with hsTRPV4 R232C-cGFP. With hsTRPV4-cGFP, only a weak band for hsDDX3X-nV5 in figure 4.14 B was detected. A 149 398 871 hsTRPV4-cGFP N PDB PRR ARD GFP C R232C hsTRPV4 R232C-cGFP N PDB PRR ARD GFP C 1 12 22 38 44 132 182 404 414 544 607 662 hsDDX3X-nV5 N V5 NTE DEAD HELICc CTE C Recombinantly expressed and purified DDX3X B C D 1,2 250 250 150 150 TRPV4 100 100 75 75 1,0 Heavy chain 50 50 37 37 0,8 Light chain 250 250 0,6 150 150 100 100 75 75 Heavy chain 0,4 50 50 37 37 Light chain 0,2 DDX3X 0,0 75 75 50 Heavy chain50 Input (5 %) Co-IP (a-GFP) Input (5 %) Co-IP (a-GFP) Figure 4.14: Co-Immunoprecipitations (co-IPs) of full-length human TRPV4-cGFP and TRPV4 R232C-cGFP, respectively, in HEK293T cells show an increased DDX3X-V5 pulldown with the neuropathy-causing TRPV4-R232C mutation. A Topol- ogy models of human full-length TRPV4 constructs and DDX3X used for co-expression in HEK293T cells. For TRPV4, important N-terminal domains, namely the proline rich region (PRR), phosphoinositide-binding domain (PBD) and ankyrin repeat domain (ARD), are highlighted. GFP = Green-fluorescent protein, V5= V5-tag (single letter code: GKPIPNPLLGLDST), NES = nuclear export sequence, elF4E = binding site of transcription factor elF4E, NTE= N-terminal extension, DEAD = DEAD domain (RecA-like domain 1), HELICc = C-terminal helicase domain (RecA-like domain 2), CTE = C-terminal extension.148 B + C Two α-GFP co-IPs with full-length human TRPV4-cGFP and TRPV4 R232C-cGFP, respectively, co-transfected with hsDDX3X-nV5 in HEK293T cells show an increased hsDDX3X-nV5 pulldown with the neuropathy-causing TRPV4-R232C mutation. To rule out unspecific interac- tions, soluble GFP was co-transfected with respective TRPV4 construct. D Densitometric quantification of co-immunoprecipiated hsDDX3X-nV5, normalized to immunoprecipitated hsTRPV4-cGFP of respective condition. Error bars indicate SD. Densitometry was performed with Fiji. 108 hsDD G XF 3P X-nV h 5s G DF DP X3X- h ns VT 5R +P h Vs 4D -hs D cG T X FR 3P X P - h Vs 4 nV T -R c 5 P G + V Fh 4 Ps h DD Rs 2T 3R X 2P 3X C M V -n -cG [ 4 Vk 5 FD R + Pa 2] 32C-c h GsD FD P G XF 3P X-nV h 5s G DF DP X3X- h ns VT 5R +P h V4 NESsD -hs D cG T X FR 3P X P V -h 4 ns VT - 5R cG +P F elF4E h V Ps 4 h DsT D R X 23RP 3 2 X C V -n -c4 V GR F2 5 + P32C-cGFP hsDDX G 3F XP -nV h 5s G DF DP X3X- h ns VT 5R +P h Vs 4-c h DD GsT X FR 3 PP X h V - 4 nsT - V c 5R +P GF h V4 Ps h D Rs 2T D 3R XP 3 2 M X C V -n -c [k 4 R V G D 2 5 F + Pa] 32C-c h GsD FD PX G 3F XP -nV h 5s G DF DP X3X- h ns VT 5R +P h Vs 4-c h D Gs DT X FR 3X PPV -h ns 4- VTR c 5 P G + V Fh Ps 4 h D Rs 2T DR X 32 P 3X CV -n -c4 GR V F2 5 P3 +2C-cGFP a-V5, 5 min a-GFP, 5 min a-GFP, 30 sec DDX3X IP band intensity hsTRPV4-nGFP hs h Ds DT XR 3P XV -4 n- Vc 5G +FP h R s2 T3 R2 PC V-c 4GFP hsDD h X R s 3X 2 TR -3 n2 P VC V 5- +c 4GFP Chapter 4. Results Even though the amount of co-immunoprecipitated hsDDX3X-nV5 is low, the in the ATPase as- says (figure 4.13) observed trend of a stronger DDX3X-TRPV4 R232C interaction compared to wild-type TRPV4 persisted. In the last few years, pathological stress granule formation more and more emerged to be one possible cause of neurodegenerative diseases such as the TRPV4-associated Charcot-Marie-Tooth Type 2C disease. These membraneless organelles form in cellulo upon oxidative and hyperosmotic stress, amongst others, as a consequence of stress-induced translational shutdown and polysome disassembly.121,149 Stress granules are composed mainly from RNA-binding proteins like DDX3X and form highly dynamic structures upon acute stress, whereas chronic cellular stress is proposed to induce pathologically stable complexes that might promote the formation of aggregates.149–151 Based on the elevated DDX3X-TRPV4 R232C interaction shown in subchapter 4.1.2 and in fig- ures 4.13 and 4.14, fluorescence microscopy experiments with HEK293T cells co-transfected with the same constructs used as in the co-IPs in figure 4.14 were performed to investigate prob- able foci formations of DDX3X in the presence of TRPV4 and/or neuropathy causing TRPV4 R232C (figure 4.15). Transiently transfected HEK293T cells showed expected subcellular lo- calization of respective proteins, namely hsDDX3X-nV5 in the cytosol and hsTRPV4-cGFP in the plasma membrane. In the case of hsTRPV4 R232C-cGFP, beside the plasma membrane localization also GFP-containing foci were observed. For hsDDX3X-nV5 alone an uniform cytosolic distribution was observed, whereas in the presence of hsTRPV4-cGFP densifica- tions formed. These hsDDX3X-nV5 densifications were more pronounced and spatially dis- tinct as foci in the presence of hsTRPV4 R232C-cGFP. hsDDX3X-nV5 and hsTRPV4-cGFP or hsTRPV4 R232C-cGFP co-expression did not alter the subcellular localization of both TRPV4 constructs. These results indicate an influence of TRPV4 on DDX3X-containing foci forma- tion in cellulo. Valentin-Vega et al. showed that medulloblastoma-associated mutations in DDX3X, leading to deficiency in RNA-stimulated ATP-hydrolysis of DDX3X, spur stress gran- ule hyperassembly.119,142 Therefore, not only the increased basal Ca2+ influx levels due to the neuropathy causing R232C mutation could lead to abnormal stress granule formations, but also the elevated ATPase inhibition due to an increased DDX3X interaction with the mutated hsV4 ARD. Donate-Macian et al. showed a decreased DDX3X co-IP with TRPV4 in Huh7 cells Figure 4.15 (facing page): Fluorescence microscopy images of HEK293T cells co-transfected with TRPV4-GFP (green) and DDX3X-V5 (magenta) reveal cytosolic DDX3X densifications (white arrow heads), especially in the presence of TRPV4- R232C-GFP. V5-tag of DDX3X was detected via mouse anti-V5 primary antibody and subsequent Alexa Fluor™647-coupled anti-mouse secondary antibody staining. Nuclei were stained with DAPI. Scale bar = 10µm. Images were taken with a Zeiss Axio Observer Z1 inverted widefield microscope. 109 Chapter 4. Results DDX3X-V5 hsTRPV4-cGFP DAPI 110 hsDDX3X-nV5 hsTRPV4-cGFP hsDDX3X-nV5 + hsTRPV4 R232C-cGFP hsDDX3X-nV5 + hsTRPV4-cGFP hsTRPV4 R232C-cGFP Chapter 4. Results upon treatment with the TRPV4 activator GSK1016790A (GSK-101), inducing TRPV4-mediated Ca2+-influx. Additionally, TRPV4-mediated Ca2+-influx, activated either via hypotonicity or the TRPV4 agonist GSK-101, induced partial shuttling of DDX3X into the nucleus in HEK293 cells via a Ca2+/Calmodulin-dependent pathway. This shuttling behavior was not observed with the gain-of-function R232C mutation in TRPV4 in this thesis (figure 4.15).54,136 In summary, the results by Donate-Macian et al. indicate a disruption of the TRPV4-DDX3X PPI upon TRPV4 activation.136 In combination with the results shown in this thesis, the increased TRPV4 R232C- DDX3X PPI seems to be Ca2+-influx independent, as TRPV4 R232C was previously shown to exhibit elevated basal Ca2+-influx activity.54 The TRPV4 R232C-DDX3X PPI seems to be ele- vated due to mutation-induced electrostatic and structural changes within and between the two proteins. These findings underline the importance of stress granule homeostasis and the severe consequences of dysregulation in stress granule dynamics, which ultimately leads to neuronal cell death.119 The data shown in this thesis reveal TRPV4 as a potential communication hub for downstream processes involved in stress granule formation. 111 Chapter 4. Results 4.3 It is all about humanity - an in cellulo study of the interaction between human TRPV4 and PACSIN1-3 Besides the six ankyrin repeats organized in an ankyrin repeat domain (ARD), the hsV4N con- tains a proline rich region (PRR, aa 132 – 144) which is necessary for the interaction with PACSIN3 (Protein kinase C and casein kinase substrate in neurons 3), one of the few known direct interactors of TRPV4.70 All three PACSIN isoforms consist of a F-BAR domain, a linker domain and a SH3 domain, of which the latter interacts with the TRPV4 PRR (see figure 4.16 F).22,70,71 Previous experiments evaluated the physiological role of PACSIN3 in TRPV4 modu- lation, where it was shown that the relative plasma membrane amount of TRPV4 is enhanced by PACSIN3, but not by PACSIN1 and 2, despite of co-IPs of all three mouse PACSINs with rat TRPV4.70 Furthermore, D’hoedt et al. showed that PACSIN3 desensitizes TRPV4 and inhibits its activation by cell swelling induced via a hypoosmotic solution and heat, but not by chemi- cal stimuli like the known TRPV4 activator 4α-phorbol 12,13-didecanoate (4α-PDD). Although these previous experiments comprehensively evaluated the physiological role of PACSIN3 in TRPV4 modulation, data about the roles of PACSIN1 and PACSIN2 are lacking.70,71 Also, be- fore mentioned experiments where performed with rodent proteins (mouse PACSINs and rat TRPV4 or mouse TRPV4) in a human expression system (HEK293T cells). To elucidate the role of all PACSINs in TRPV4 modulation, in this work human full-length PACSINs and TRPV4 were co-expressed in HEK293T cells to gain a comprehensive and species consistent view on the physiological role of these PPIs. Following the initial studies of D’hoedt et al.71 showing dampened TRPV4-mediated Ca2+-influx upon hypotonicity by PACSIN3 in HEK293T cells, a Fura-2 AM-based Ca2+-influx assay was performed (see figure 4.16 A). HEK293T cells co- transfected with human full-length TRPV4 and PACSIN1 or PACSIN3, respectively, show signif- icant dampened TRPV4-mediated Ca2+-influx in comparison to cells transfected with TRPV4 alone or co-transfected with PACSIN2. Furthermore, PACSIN1 and PACSIN3 dampen the basal Ca2+-influx activity of TRPV4 (t=0). Figure 4.16 B shows that PACSIN1 and 3, but not PAC- SIN2, co-immunoprecipitate with TRPV4, which is in disagreement with the co-IPs performed with the rodent PACSIN orthologues and TRPV4.70 As expression levels of all three PACSINs in figure 4.16 are on a comparable level, these results underline the difference of PPIs between protein orthologues across species, even in the context of high protein identities (see section 6.5). 112 Chapter 4. Results A B 2,4 2,4 Hypotonicity GSK-101 2,2 2,2 2,0 2,0 1,8 1,8 1,6 1,6 1,4 1,4 1,2 1,2 1,0 1,0 0,8 0,8 0,6 0,6 0,4 0,4 0,2 EV TRPV4-FLAG 0,2PAC1-V5 PAC2-V5 PAC3-V5 EV TRPV4-FLAG PAC1-V5 PAC2-V5 PAC3-V5 +TRPV4-FLAG +TRPV4-FLAG 0,0 0,0 0 100 200 300 400 0 100 200 300 400 time [s] time [s] * C 2,0D 1,8 1,6 M 1,4 [kDa] 1,2 150 1,0 100 0,8 75 0,6 0,4 50 0,2 37 0,0 Input (5 %) co-IP (a-FLAG) E F PACSIN1-V5 PACSIN2-V5 PACSIN3-V5 1 444 PACSIN1 N V5 F-BAR SH3 C 1 486 PACSIN2 N V5 F-BAR SH3 C 1 424 PACSIN3 N V5 F-BAR SH3 C 1 871 TRPV4 N FLAG PDB PRR ARD C -FLAG TRPV4-FLAG/PACSIN-V5/DAPI Figure 4.16: Human PACSIN1 and 3, but not PACSIN2, dampen human TRPV4-mediated Ca2+-influx in transiently co- transfected HEK293T cells upon hypotonicity. A HEK293T cells transiently co-transfected with TRPV4-FLAG and PACSIN1- 3-V5, respectively, were loaded with the calcium indicator Fura-2 AM and treated with hypotonic saline (30 mM NaCl) at time = 0. Intracellular calcium levels were measured by acquiring 340 nm/380 nm ratio images every 10 s for 480 s. EV = transfection with empty vector. Averages represent n = 3, where each measurement was conducted with 4 coverslips with 20-30 cells per coverslip per condition. Error bars indicate SD. x-axis = time in s, y-axis = Fura 2-AM 340 nm/380 nm wavelength ratio. B HEK293T cells transiently co-transfected with TRPV4-FLAG and PACSIN1-3-V5, respectively, were loaded with the calcium indicator Fura- 2 AM and treated with 30 nM of the TRPV4 agonist GSK-101 at t = 0. Fore more experimental details see subfigure A. C Representative α-FLAG co-immunoprecipitation of TRPV4-FLAG and PACSIN1-3-V5, respectively, co-transfected in HEK293T cells show co-immunoprecipitation of PACSIN1 and 3, but not PACSIN2, with TRPV4-FLAG.D Densitometric quantification of co- immunoprecipiated PACSINs, normalized to immunoprecipitated TRPV4-FLAG of respective condition. Paired two-tailed t-test, n=3 from three independent co-IPs, *p ≤ 0.05. Error bars indicate SD. Densitometry was performed with Fiji. E Immunofluorescence images of HEK293T cells co-transfected with TRPV4-FLAG (red) and PACSIN1-3-V5 (green), respectively, show proper cellular distribution of overexpressed constructs with TRPV4-FLAG in the plasma membrane and PACSIN1-3-V5 in the cytosol. FLAG- tag was detected with rabbit α-FLAG and subsequent α-rabbit Alexa Fluor 555 staining. V5-tag was detected with mouse α-V5 and subsequent α-mouse Alexa Fluor 488 staining. Nuclei were stained with DAPI. Scale bar = 10µm. Images were taken with a Zeiss LSM800 Confocal Microscope. F Topology model of expressed PACSIN constructs. V5= V5-tag (single letter code: GKPIPNPLLGLDST), FLAG = FLAG tag (single letter code: DYKDDDDK) 113 Fura-2 ratio (340/380) TR P PA V C 4 1 -- F P V LA A 5 G C 1 +- T V P R 5 A P C V 2 4- -V F5 LP AA G C 3 +-V T 5 P RA P C V 3 4- -V F5 LAG + TR PV4- T FR L P APA V G C 4 1 -- F P V L A 5 A C G 1 +-V T 5 P RA P C V 2 4-F P -V LA 5 A C G 3 - +V T 5 P RA P C V 3 4- -V F5 LAG + a-V5, 30 sec a-FLAG, 30 sec Fura-2 ratio (340/380) TR P PA V C 4 1 -- FV L5 AG + T P RA P C V 2 4- -V F5 LAG + T P RA P C V 3 4- -V F5 LAG + Chapter 4. Results To confirm functional expression of TRPV4, complementary Ca2+-influx experiments were per- formed with the potent TRPV4 agonist GSK-101, showing no PACSIN-mediated TRPV4 Ca2+- influx dampening (see figure 4.16 C).70,152,153 Additionally, immunofluorescence images in fig- ure 4.16 D show proper subcellular distributions of expressed constructs in cellulo. PACSIN3 mRNA transcripts were mainly found in skeletal and heart muscle tissue, whereas PACSIN2 transcripts were detected ubiquitously and PACSIN1 transcripts showed neurospeci- ficity.154 Interestingly, co-expression of the neuropathy-causing TRPV4 R269C mutation and PACSIN1 showed a strong trend towards a loss of TRPV4-mediated Ca2+-influx inhibition in HEK293T cells upon hypotonicity, whereas PACSIN3 still retained its desensitizing role in TRPV4 regulation (figure 4.17). In agreement with Woolums et al., Ca2+-influx experiments indicate higher basal TRPV4 R269C Ca2+-influx activity compared to wild-typic TRPV4 (t = 0) .53 Despite the loss of the PACSIN1-desensitizing function upon stimuli induced TRPV4 R269C activation, co-expression of PACSIN1 with TRPV4 R269C still seems to dampen basal TRPV4 mediated Ca2+-influx (t=0). To substantiate these trends, additional Ca2+-influx assays are required. A first co-IP hints towards a loss of PACSIN1-binding to TRPV4 R269C (figure 4.17 B). These results indicate a neuron-specific consequence of the neuropathy-causing TRPV4 R269C mutation, also regarding the above mentioned tissue specific mRNA transcription of the three PACSIN isoforms. The mechanisms of PACSIN-mediated TRPV4 modulation still remain elusive until this date. Neurons are more vulnerable towards chronic Ca2+-influx compared to other cell types due to their unique cellular structure, which lead to higher sensitivity towards Ca2+-dyshomeostasis with excitotoxicity as a possible consequence .155 As the desensitizing function of PACSIN1 precedes upon the TRPV4 R269C mutation in neurons, other tissues are possibly still able to regulate TRPV4-mediated Ca2+-influx via PACSIN3 and/or other until now not known TRPV4 regulating mechanisms. To shed light on the PPI between the PACSINs and the TRPV4 PRR, in chemical shift pertur- bation assays using nuclear magnetic resonance (NMR) spectroscopy, Goretzki et al. probed structural changes of the different PACSIN SH3 domains upon interacting with the TRPV4- PRR.22 All three SH3 domains interact with the TRPV4-PRR in a highly comparable manner. These experiments showed that the SH3 domains of PACSIN1, 2 and 3 interact with the TRPV4- PRR through the same binding interfaces and have highly similar binding affinities. However, co-IPs (figure 4.16 B) showed that PACSIN3 binds better to TRPV4 than PACSIN1, and that PACSIN2 does not bind to TRPV4 in cellulo at all. This strongly hints towards a difference in the TRPV4-PACSIN3 interaction compared to its interaction with PACSIN1 in the context of full-length PACSINs and full-length TRPV4. 114 Chapter 4. Results A B 1,6 Hypotonicity M [kDa] 1,4 150 100 1,2 75 1,0 50 37 0,8 0,6 150 100 0,4 75 0,2 EV TRPV4-FLAG PAC1-V5 PAC2-V5 PAC3-V5 50 TRPV4 R269C-FLAG +TRPV4 R269C-FLAG 37 0,0 0 100 200 300 400 time [s] Figure 4.17: Human PACSIN1 does not dampen TRPV4-mediated Ca2+-influx in HEK293T cells transiently transfected with TRPV4 R269C upon hypotonicity. A HEK293T cells transiently co-transfected with TRPV4-FLAG or neuropathy-causing TRPV4 R269C-FLAG and PACSIN1-3-V5, respectively, were loaded with the calcium indicator Fura-2 AM and treated with hypotonic saline (30 mM NaCl) at time = 0. Intracellular calcium levels were measured by acquiring 340 nm/380 nm ratio images every 10 s for 480 s. EV = transfection with empty vector. Averages represent n = 2, where each measurement was conducted with 4 coverslips with 20-30 cells per coverslip per condition. x-axis = time in s, y-axis = Fura 2-AM 340 nm/380 nm wavelength ratio. B α-FLAG co-immunoprecipitation of neuropathy-causing TRPV4 R269C-FLAG and PACSIN1-3-V5, respectively, co-transfected in HEK293T cells show only co-immunoprecipitation of PACSIN3 with TRPV4, but not PACSIN1 and 2. Since Goretzki et al. have excluded the SH3 domain as the origin of these differences, the next step was to focus on the F-BAR domains.For this, the three F-BAR domains of PACSIN1-3 where exchanged while retaining the linker and SH3 domain of the original PACSIN via Gib- son Assembly.79,80 Of these originally six cloned constructs, only three showed expression in HEK293T cells (see figure 4.18 C for detailed chimera construct composition). Figure 4.18 A shows the results of Fura-2 AM-based Ca2+-influx assays performed with HEK293T cells co- transfected with TRPV4 and respective PACSIN chimeras treated with hypotonic saline. Both PACSIN chimeras that combine the PACSIN1 linker and SH3 domain with either the PACSIN2 or PACSIN3 F-BAR domain (PACSIN2+1 and PACSIN3+1, figure 4.18 C), respectively, show no regulation of TRPV4-mediated Ca2+-influx upon hypotonicity. Strikingly, PACSIN chimera PACSIN2+3, consisting of the PACSIN2 F-BAR domain with PACSIN3 linker and SH3 domain, shows comparable Ca2+-influx dampening to PACSIN3-mediated dampening (figure 4.16 A). Co-IPs with TRPV4-FLAG and N-terminally V5-tagged PACSIN chimeras could not show a pulldown of any PACSIN chimera with TRPV4. Immunofluorescence images (figure 4.18 D) confirmed proper cellular distribution of the PACSIN chimeras in the cytosol and TRPV4 in the plasma membrane. 115 Fura-2 ratio (340/380) Input (5 %) Co-IP (a-FLAG) TR PV4 P RA 2 C 6 1 9- CV - PA 5 FLA C G 2-V P 5A C 3-V5 T P RA P C V 1 4 T - V R2 P R 5 6 A P 9 C V C -F 2 4 T - V R L 2 AR 5 6 GP A P 9V C +C 4 -3- R FL a-V5, a-FLAG, a-V5, a-FLAG, V5 26 A 9 G 30 sec 30 sec +30 sec 30 sec C-FLA G + Chapter 4. Results A B Hypotonicity 1,6 1,4 M 1,2 [kDa] 150 1,0 100 75 0,8 50 0,6 37 0,4 Input (5 %) co-IP (a-FLAG) 0,2 EV TRPV4-FLAG PAC2+1-V5 PAC3+1-V5 PAC2+3-V5 +TRPV4-FLAG 0,0 0 100 200 300 400 time [s] C D 1 11 282 385 444 PACSIN2+1-V5 PACSIN3+1-V5 PACSIN2+3-V5 PACSIN2+1 N V5 F-BAR Linker SH3 C PACSIN2 PACSIN1 1 10 280 385 444 PACSIN3+1 N V5 F-BAR Linker SH3 C PACSIN3 PACSIN1 111 282 363 424 PACSIN2+3 N V5 F-BAR Linker SH3 C PACSIN2 PACSIN3 TRPV4-FLAG/PACSIN-V5/DAPI Figure 4.18: PACSIN chimeras hint towards different regulation modes between PACSIN1 and PACSIN3 on TRPV4- mediated Ca2+-influx in HEK293T cells. A HEK293T cells transiently co-transfected with TRPV4-FLAG and respective PACSIN chimera shown in subfigure C, respectively, were loaded with the calcium indicator Fura-2 AM and treated with hypotonic saline (30 mM NaCl) at time = 0. Intracellular calcium levels were measured by acquiring 340 nm/380 nm ratio images every 10 s for 480 s. EV = transfection with empty vector. Averages represent n = 3, where each measurement was conducted with 4 coverslips with 20-30 cells per coverslip per condition. Error bars indicate SD. x-axis = time in s, y-axis = Fura 2-AM 340 nm/380 nm wavelength ratio. B Representative α-FLAG co-immunoprecipitation of TRPV4-FLAG and respective PACSIN chimera (see subfigure C) co- transfected in HEK293T cells show no co-immunoprecipitation of the PACSIN chimeras with TRPV4-FLAG. C Topology model of expressed PACSIN chimeras. For this the three F-BAR domains of PACSIN1-3 where exchanged while retaining the linker and SH3 domain of the original PACSIN. Of these originally six cloned constructs, only the pictured three showed expression in HEK293T cells. V5= V5-tag (single letter code: GKPIPNPLLGLDST), FLAG = FLAG tag (single letter code: DYKDDDDK). D Immunofluo- rescence images of HEK293T cells co-transfected with TRPV4-FLAG (red) and respective PACSIN chimera show proper cellular distribution of overexpressed constructs with TRPV4-FLAG in the plasma membrane and the PACSIN chimeras in the cytosol. FLAG-tag was detected with rabbit α-FLAG and subsequent α-rabbit Alexa Fluor 555 staining. V5-tag was detected with mouse α-V5 and subsequent α-rabbit Alexa Fluor 488 staining. Nuclei were stained with DAPI. Scale bar = 10µm. Images were taken with a Zeiss LSM800 Confocal Microscope. These results indicate different TRPV4-regulation modes between PACSIN1 and PACSIN3. Whereas PACSIN1 seems to need its F-BAR domain, PACSIN3 seems to regulate TRPV4- mediated Ca2+-influx either F-BAR-independently or the PACSIN2 F-BAR domain is sufficient enough to substitute the PACSIN3 F-BAR domain (see also section 6.5 for mutliple sequence alignment between human PACSIN F-BAR domains, indicating a higher sequence identity be- tween the PACSIN2 F-BAR domain and PACSIN3 F-BAR domain than between the PACSIN1 F-BAR domain and PACSIN3 F-BAR domain). Cuajungco et al. showed that PACSIN3 lacking 116 Fura-2 ratio (340/380) TR PV4 T -R FP LA P A C V G 2 4- T + FR 1 LP - AA P V C V 5 G 4 +3+ -F T 1 LR -V AP P 5 GA V +C 2 4+ -F3 L-V A5 G + TR PV4 T -R FP LA P A C V G 2 4+ -T F P R 1 L P -V AA 5 G C V4 +3+ -F T 1 LR -V APA P 5 G C V + 2 4+ -F3 L-V A5 G + a-V5, 30 sec a-FLAG, 30 sec Chapter 4. Results the F-BAR domain lost its ability to dampen TRPV4-mediated Ca2+-influx upon hypotonicity in HEK293T cells.70 This would hint towards the ability of the PACSIN2 F-BAR domain to substi- tute the PACSIN3 F-BAR domain. BAR domain-containing proteins like PACSIN1-3 are known to induce various forms of membrane deformations.156,157 Membrane deformation experiments conducted by Goh et al. showed that the isolated F-BAR domains of PACSIN2 and PACSIN3 produced similar membrane morphologies after incubation with liposomes. Whereas PAC- SIN2 and 3 F-BAR proteins mainly induced formation of vesicular structures and wide tubules, the PACSIN1 F-BAR domain additionally induced narrow tubule formation. Additionally, Bai et al. showed in liposome tubulation assays that PACSIN3 induced low curvature tubulation with mainly tubule formation diameters from 90 nm to 110 nm, whereas PACSIN1 also addi- tionally formed high curvature tubules, ranging from 10 nm to 200 nm. In this case, PACSIN2 again showed an intermediate behavior between PACSIN1 and 3, where PACSIN2-induced tubules showed a diameter range like PACSIN1, but the relative number of low-curvature tubes is higher compared to PACSIN1. It was shown previously that TRPV4-activation indeed is de- pendent from the surrounding membrane fluidity and stiffness and thus different degrees of membrane curvatures could also play a regulatory role in TRPV4 regulation.158 As the different PACSIN isoforms serve different levels and forms of membrane deformations, PACSIN isoform dependent TRPV4 regulation via the F-BAR mediated membrane microenvironment seems to be an explanation for the possible different TRPV4-regulation modes between PACSIN1 and 3.156,157,159,160 These findings also underline the probable ability of the PACSIN2 F-BAR do- main to induce similar membrane curvatures like the PACSIN3 F-BAR domain. Therefore the PACSIN2 F-BAR domain may probably serve comparable local membrane environments for TRPV4 in the context of the PACSIN chimera 2+3.156,160 Membrane deformation activity as- says with all three murine full-length PACSIN isoforms showed reduced membrane deformation activity compared to the isolated F-BAR domains, whereby full-length PACSIN1 showed a sig- nificantly higher activity loss than PACSIN3. PACSIN2 showed again an intermediate behavior, where an activity decrease was also observed, but this decrease was not as pronounced as for PACSIN1. Membrane deformation activity reduction might occur due to the autoinhibition by the SH3 domain binding on the F-BAR domain, preventing the F-BAR domain to interact with membranes. This particular autoinhibition was shown for PACSIN1 in a X-ray crystal structure of murine PACSIN1 (PDB: 2X3X), where a negatively charged triple motif (Q396, E397, E400) in the SH3 domain interacts with a basic lysine patch (K141, K145, K148) in the F-BAR do- main. This was confirmed with site-directed mutagenesis with subsequent pull-down assays in cellulo.156,157 As the substrate-binding site of the SH3 domain overlaps with the SH3/F-BAR 117 Chapter 4. Results domain interacting site, it was shown that the dynamin-PRR interrupts PACSIN1 autoinhibition and induces PACSIN1-mediated lipid tubulation.156 This autoinhibition mechanism was also proposed for PACSIN2 and 3, as the SH3 and F-BAR domains amongst the isoforms are highly conserved, including the SH3/F-BAR domain interaction sites. Indeed, Goretzki et al. could show via NMR spectroscopy that the PACSIN3 SH3 domain interacts with the PACSIN3 F-BAR domain and that a QEE/RRR mutation in the PACSIN3 SH3 domain abrogated this interaction. Furthermore, the interaction between PACSIN3 SH3 and F-BAR seemed to be comparably weak and could be released with a TRPV4-PRR containing peptide in a similar manner to the dynamin-PRR-mediated autoinhibition-release of PACSIN1.23,156 The strength between the SH3 and F-BAR domain interaction of PACSIN1 and 2 still have to be determined and variations in respective KD values could serve as another explanation for the different TRPV4-mediated behaviors between the three PACSIN isoforoms and the possible ability of the PACSIN2 F-BAR domain to substitute the PACSIN3 F-BAR domain in the chimera PACSIN2+3. Expression of the PACSIN chimera consisting of PACSIN1 F-BAR domain and PACSIN3 linker and SH3 do- main was not possible. Therefore it remains elusive, if the PACSIN1 F-BAR domain could also substitute the PACSIN3 F-BAR domain like occured in PACSIN chimera 2+3. Another explanation for the different TRPV4-regulation outcomes of the PACSIN chimeras could be different protein interactomes of PACSIN1 and 3, due to their different tissue distributions and minor differences in amino acid sequences.154 Goretzki et al. proposed that PACSIN3 possi- bly binds to TRPV4 as a dimer, where the F-BAR domains mediate the PACSIN3 dimerization. One SH3 domain therefore would interact with the TRPV4 PRR, whereas the other SH3 domain could recruit additional TRPV4 binding partners. Furthermore, PACSIN3 is the only PACSIN isoform that contains a proline rich region in its linker region (aa 337-345), with which other proteins could interact with. PACSIN chimera 3+2 thus seems still to be able to bind to the TRPV4 PRR via its SH3 domain, exposing the PACSIN3 PRRs in the linker domains and the other SH3 domain for further protein interactions to form a multicomponent TRPV4 signaling complex. This could be an additional determinant for a PACSIN3- and therefore tissue specific protein interactome, which leads to a robust PACSIN3- TRPV4 interaction, whereas PACSIN1 loses its binding and consequently TRPV4 regulation ability in the presence of the neuropathy-causing TRPV4 R269C mutation. Expression lev- els of the PACSIN chimeras in HEK293T cells were significantly lower compared to wild-type PACSIN1-3 (see figure 4.16 B), which could also be a reason for the missing co-IP of any of the PACSIN chimeras with TRPV4. Low-affinity or transient PPIs may not be detected in co-IPs, as extensive washing and mechanical/chemical stresses during the experiment could 118 Chapter 4. Results disrupt the PPI of the target complex. Therefore it would still be possible that the chimera PAC- SIN2+3 still directly binds to TRPV4 via its SH3 domain in cellulo, leading to a TRPV4 regulation. This would indicate that already low amounts of a TRPV4-regulating PACSIN isoforms/chimera are sufficient to achieve TRPV4-mediated Ca2+-influx dampening and also explain the simi- lar Ca2+-influx dampening effect of PACSIN1 and PACSIN3 (figure 4.16 A) even though the TRPV4-PACSIN1 interaction seems to be weaker in the context of HEK293T cells (figure 4.16 B). 119 Chapter 4. Results 4.4 Small but powerful - the small GTPase RhoA interacts with the TRPV4 Ankyrin Repeat Domain Parts of this chapter were published in: McCray, B.A., Diehl, E. et al. Neuropathy-causing TRPV4 muta- tions disrupt TRPV4-RhoA interactions and impair neurite extension. Nat Commun 12, 1444 (2021).69 The author of the present thesis (Erika Diehl) contributed purification, characterization and nuclear mag- netic resonance (NMR) spectroscopy-based PPI studies between recombinantly expressed 15N-RhoA and hsV4 ARD wt as well as hsV4 ARD R269C. TRPV4 modulates cell morphology and stiffness via cytoskeleton components, namely mi- crotubules and actin scaffolds.69,161–165 A generic bottom-up proteomics approach, conducted by MD (RG , Department of Neurology, Johns Hopkins University School of Medicine) with immunopurified human TRPV4-FLAG overexpressed in HEK293T cells indicated the small GTPase RhoA as a putative direct TRPV4 interactor.69 These data complemented the recently published TRPV4-RhoA interaction identified via a Y2H screen.136 RhoA itself is a pivotal regulator of the actin cytoskeleton, inducing stress fiber formation, for example.166–168 Therefore a possible direct PPI and actin regulating interplay between TRPV4 and RhoA was investigated and if these putative interactions were aberrant in the presence of disease-causing mutations of TRPV4. MD could show with comprehensive co-IP studies in HEK293T and MN-1 (a murine cholinergic motor neuron cell line) cells, that TRPV4 pulls down RhoA and vice versa. Furthermore, co-IPs of MN-1 cells transiently trans- fected with TRPV4 and inactive RhoA-GFP (T19N), or constitutively active RhoA-GFP (Q63L) demonstrated that TRPV4 interacts with inactive, GDP-bound RhoA T19N, but not active, GTP- Figure 4.19 (facing page): Purification of hsV4 ARD wt, hsV4 ARD R269C and 15N-isotope labeled human RhoA (15N-RhoA ). A Schematic topology model of hsV4 ARD wt, hsV4 ARD R269C and 15N-RhoA used for NMR spectroscopy measurements. His6 = hexa-histidine tag (single letter code: HHHHHH), TEV = Tobacco Etch Virus Cleavage Site (single letter code: ENLYFQG). His6-tags with preceding or subsequent TEV Cleveage Site were removed. B SEC purifications of 15N-RhoA, hsV4 ARD wt and R269C. SEC runs were performed with a HiLoad Superdex 75 pg preparative SEC column. Inlets show Coomassie stained 15 % SDS-PAGEs of collected and concentrated fractions after SEC. x-axis: eluted volume in mL, y-axis: absorbance at 280 nm, M = marker. C For 15N-RhoA, the intrinsic GTPase activity was determined via the luminescence-based GTPase-Glo Assay. GTPase activity is inversely correlated to measured luminescence intensity. A paired two-tailed t-test with 3 independent measurements including 4 technical replicates was performed, ***p < 0.001. Error bars indicate SD. D + E Far UV CD spectra of purified hsV4 ARD wt and hsV4 ARD R269C as well as 15N-RhoA, respectively. Spectra were measured at 293 K and proteins were used at 1µM concentration in RhoA SEC buffer with a final concentration of 20 mM NaCl. F Secondary structure prediction of shown far UV CD spectra shown in subfigures D and E, performed with CAPITO.93 The predicted α-helix/β-sheet/random coil content of the purified proteins is for hsV4 ARD wt 78 %/0 %/22 %, hsV4 ARD R269C 68 %/0 %/32 % and 15N-RhoA 27 %/24 %/49 %. y-axis: mean residue ellipticity ([Θ]mrw,λ) in 10−3 deg cm2 dmol−1, x-axis: wavelength λ in nm. 120 Chapter 4. Results A B 350 15 MW N-hsRhoA [kDa] Coomassie hsV4 ARD wt 300 hsV4 ARD R269C 75 1 193 250 50 hsRhoA N His6 TEV RhoA C 37 200 149 398 25 hsV4 ARD wt N ARD His C 150 A t 9C6 Rh o w 15 26R R269C 10 hsV4 ARD R269C N ARD His C 1006 hsV4 ARD 50 Superdex 75 0 50 60 70 80 90 100 40 C D Volume [mL] 60 25 15 hsV4 ARD wt N-hsRhoA hsV4 ARD R269C 20 40 15 10 20 5 0 0 -5 -10 -20 -15 -20 -40 -25 200 210 220 230 240 250 260 200 210 220 230 240 250 260 l [nm] l [nm] E F *** 1 .0 random coil 120000 b-sheet 0 .9 a-helix 0 .8 100000 0 .7 80000 0 .6 0 .5 60000 0 .4 0 .3 40000 0 .2 0 .1 20000 0 .0 hs- w t 9C 5 0 1 N oA 2 6 l s h R nt ro h R 15 o N - oA hsV4 ARDC Rh 121 3 2 -1 q [10 deg cm dmol ] mrw, l Luminescence [RLU] 3 2 -1 q [10 deg cm dmol ] Abs [mAu] mrw, l 280nm sec. structure content Chapter 4. Results bound RhoA Q63L.169 These results were further confirmed with Co-IPs in the presence of ei- ther excess GDP or an unhydrolyzable GTP analog (GTPγS) to favor the inactive or active form of RhoA. Additionally, co-IPs with immunopurified RhoA-myc and recombinantly expressed, purified human TRPV4 N-terminus (hsV4N) and ARD (hsV4 ARD), respectively, indicated a direct interaction between these proteins. Further co-IPs in transiently transfected MN-1 cells showed an abolished TRPV4-RhoA PPI in the presence of neuropathy-causing TRPV4 mutants (R232C, R237L, R269C, R315W), but not skeletal dyplasia-causing mutations (I331F, D333G). These neuropathy-mutant PPI disruptions were shown to be TRPV4-channel activity indepen- dent, as neither the TRPV4 anatgonist HC-067047 (HC-067) nor the pore-blocking M680K mu- tation restored the PPI between RhoA and TRPV4 harboring respective neuropathy-causing mutations. 15 I80 E47 N-RhoA15 N-RhoA + hsV4 ARD wt 15 15 N-RhoA + hsV4 ARD R269C N d [ppm] L57 V139 R150 K6 V48 I95 A3 D59 D49 E172 Y42 L81 E40 A2 V53 I10 V9 V35 E47 V43 I113 E54M82 W58 I80 V35 V115 L55 F30 R5 E54 9 8 W58 M82 L57 V139 R150 K6 V48 I95 A3 D59 D49 E172 Y42 L81 E40 A2 V53 I10 V9 E47 V43 I113 E54M82 V35 W58 I80 V115 L55 F30 R5 1 9 8 H d [ppm] 1 9 8 H d [ppm] Figure 4.20: NMR experiments revealed an decreased PPI between 15N-RhoA and the neuropathy-causing mutation R269C in hsV4 ARD. Left: Representative 1D projection of 1H resonances from 2D 1H-15N NMR spectra of 15N-RhoA (grey) and in the presence of either hsV4 ARD (blue) or hsV4 ARD R269C (red). Stronger signal decreases for 15N-RhoA in the presence of hsV4 ARD versus neuropathy mutant R269C indicate a decreased interaction between 15N-RhoA and mutant ARD. Right: Sections of 2D 1H-15N-NMR HSQC spectra of 15N-RhoA: Overlay of spectra of 1H-15N-RhoA 2D HSCQs of 15N-RhoA on its own (grey) in the presence of hsV4 ARD (blue, upper right) show line broadening, indicating the formation of a high molecular weight complex. In contrast, addition of hsV4 ARD R269C (red, lower right) shows only minor effects on the 15N-RhoA spectrum. 15N-RhoA backbone NMR assignments were transferred from previously published data170. NMR spectra were recorded on a Bruker 600 MHz spectrometer equipped with a cryogenic triple probe at 298.15 K and processed using Bruker TopSpin 3.2. 122 0 5 [rel] 10 128 125 128 125 Chapter 4. Results Due to the clustering of investigated neuropathy-causing TRPV4 mutations in the TRPV4 ARD (hsV4 ARD), the author of this thesis examined the direct PPI between recombinantly expressed and purified 15N-RhoA and wild-type hsV4 ARD (hsV4 ARD wt) as well as hsV4 ARD R269C neuropathy mutant (hsV4 ARD R269C) via nuclear magnetic resonance (NMR) spectroscopy. To characterize this PPI in detail, 1H,15N NMR measurements of RhoA in the presence of hsV4 ARD and hsV4 ARD harboring the neuropathy-causing mutation R269C (hsV4 ARD R269C) were performed. For this, recombinantly expressed hsV4 ARD and hsV4 ARD R269C, as well as 15N-labeled human GDP-bound RhoA (hereafter referred to as 15N-RhoA) were puri- fied (see subsection 3.7.5). Recombinant proteins showed the expected molecular weights via SDS-PAGE with subsequent Coomassie-staining (figure 4.19 A inlet) and secondary structures determined by CD spectroscopy (figure 4.19 D and E). Additionally, 15N-RhoA showed enzy- matic functionality in a luminescence-based GTPase assay (figure 4.19 F). After confirmation of the protein integrity, two-dimensional 1H,15N-NMR spectra of 15N-RhoA were recorded (see section 6.6 figures 6.4 and 6.5 for full spectra). The obtained spectra agreed with previously published NMR data (BMRB:16668)170 and allowed a backbone resonance assignment trans- fer of 93.6 %. NBS Switch 1 NBS Switch 2 NBS hsV4 ARD wt hsV4 ARD R269C 1,2 1 0,8 0,6 2 s 0,4 0,2 0 -0,2 -0,4 -0,6 2 s -0,8 -1 -1,2 # residues Figure 4.21: Relative signal intensity changes of RhoA in the presence of unlabeled hsV4 ARD wt and R269C, respectively. The largest decrease in signal intensity accounted for the E54 residue in 15N-RhoA, and a smaller decrease in E47, indicated by arrow heads. NBS = Nucleotide binding site, Switch 1 and 2 = Switch 1 and 2 loop, 2σ = two SDs To map the hsV4 ARD binding site on 15N-RhoA, spectra were recorded in the presence of either hsV4 ARD or hsV4 ARD R269C (see figure 4.20). Signal intensities of 15N-RhoA res- onances decreased significantly in the presence of hsV4 ARD, indicating formation of a large molecular complex between hsV4 ARD (29.3 kDa) and RhoA (21.8 kDa). Addition of hsV4 ARD R269C did not lead to such strong signal intensity decreases, indicating a reduced affinity for 15N-RhoA. To identify the 15N-RhoA residues that are strongly affected by the interaction with hsV4 ARD, the relative signal intensity for every residue in the 15N-RhoA NMR spectra were de- termined (figure 4.21). In total, peaks corresponding to 20 residues in 15N-RhoA exhibited peak 123 Norm. integral changes 1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 101 103 105 107 109 111 113 115 117 119 121 123 125 127 129 131 133 135 137 139 141 143 145 147 149 151 153 155 157 159 161 163 165 167 169 171 173 175 177 179 181 Chapter 4. Results integral decreases greater than two standard deviations (2σ) in the presence of hsV4 ARD, whereas only two residues showed this decrease with hsV4 ARD R269C. This is also reflected in the mean relative signal intensity change of 15N-RhoA in the presence of hsV4 ARD versus hsV4 ARD R269C (figure 4.22, right). Mapping the affected residues onto the crystal structure of GDP-bound RhoA (PDB: 1FTN)171 revealed that the interswitch and switch II regions of 15N-RhoA are primarily involved in hsV4 ARD binding (figure 4.22, left). The switch regions of RhoA are important regulatory sites within the small GTPase which are sensors whether RhoA is in its GDP or GTP-bound state by changing their conformational state upon the presence of hydrogen bonds to the γ-phosphate in GTP ("loading-spring" mechanism). Depending on the switch conformations, interaction of downstream effectors like Rho GDP dissociation inhibitors (RhoGDIs) and Rho guanine nu- cleotide exchange factors (RhoGEFs) are regulated.169 The largest decrease in signal intensity accounted for the E54 residue in 15N-RhoA, and a smaller decrease in E47, suggesting these residues might be particularly important in TRPV4 binding (see figure 4.21, indicated by arrow heads). These glutamic acids are unique to RhoA and are not present in the related Rho GTPases Rac1 and Cdc42, 0,25 15 N-RhoA + hsV4 ARD wt 15 consistent with the results 0,2 N-RhoA + hsV4 ARD R269C 0,15 L72 demonstrating specificity 0,1 S73 Y74 C for interaction of TRPV4 0,05 L8 A61 K6 R5 D59 0 with RhoA and not Rac1V139 W58 L57 L55 N E54 -0,05 E40 V53 or Cdc42.69 Mutation of ADP V43 -0,1 L22 A44 F25 E54 to A completely abol- -0,15 PDB: 1FTN -0,2 ished the interaction of -0,25 RhoA with TRPV4 in co- Figure 4.22: Interaction sites of hsV4 ARD with 15N-RhoA. Left : NMR signal intensities IPs conducted by MD in the presence of hsV4 ARD mapped on a crystal structure of GDP-bound human RhoA (PDB: 1FTN)171. Residues with significant decreases in signal intensity (indicated in dark Brett A. McCray, sug- purple) are predominantly localized in the RhoA switch regions. White parts correspond to gesting that E54 may be residues for which no peaks could be identified in the measured 1H-15N 2D HSQC spectra. important for electrostatic Right : Average integral change of 15N-RhoA residues in the presence of hsV4 ARD or hsV4 ARD R269C. Error bars indicate SEM. interaction with positively charged arginine residues within the hsV4 ARD that appear to be critical for RhoA binding.69 Both mutants, E47 and E54, showed preserved interaction with RhoGDI, indicating that they were properly folded and func- tional. Our observations thus provide a potential structural explanation for the disruption of RhoA interaction by neuropathogenic mutations within hsV4 ARD. MD Brett A. McCray showed 124 Mean integral change Chapter 4. Results via live Ca2+-influx assays and co-IPs with transiently transfected MN-1 cells, that RhoA bind- ing results in suppression of TRPV4 channel activity but also to RhoA inhibition. Activation of TRPV4 with the potent TRPV4 agonist GSK-101 in transfected HEK293T cells lead to RhoA activation and cytoskeletal changes. The regulation of cell morphology by an interplay between TRPV4 and RhoA was furthermore investigated by neurite-like outgrowth length quantification of MN-1 cells. MN-1 cells transfected with TRPV4 alone showed pronounced neurite-like out- growth, whereas the neuro-pathy-causing R237L mutation failed to promote neurite-like out- growth in MN-1 cells. Co-expression of RhoA with TRPV4 therefore strongly inhibited this TRPV4-mediated neurite-like outgrowth, which was rescued by RhoA inhibition of the potent and specific RhoA inhibitor exoenzyme C3 transferase. Strikingly, also the neuropathy-causing mutation TRPV4 R237L phenotype could be partially rescued via RhoA inhibition, indicating that elevated RhoA activity due to interrupted RhoA-TRPV4 interaction contributes to patholog- ical neurite-growth outcomes in TRPV4-caused neuropathies. This hypothesis was tested in vivo with a D. melanogaster model where it was found that expression of the Drosophila RhoA ortholog Rho1 by expression of dominant negative Rho1 T19N rescued neuronal degeneration with expression of neuropathy mutant TRPV4 R269C. Within this cooperation, RhoA was identified as a direct interactor of TRPV4 with its ankyrin repeat domain, a notorious hot-spot for disease-causing mutations in TRPV4. RhoA was in- dentified as a mediator of TRPV4-induced cell structure changes and the here described find- ings strongly hint towards that disruption of TRPV4-RhoA binding is one determinant of tissue- specific toxicity of TRPV4 neuropathy mutations. 125 Chapter 4. Results 4.5 All or nothing - interaction of ITCH requires the full TRPV4 N-terminus in vitro Ubiquitination and deubiquitination of transmembrane proteins are key mechanisms in regulat- ing their surface expression. Wegierski et al. showed that ITCH-mediated TRPV4 ubiquitina- tion does not increase TRPV4 degradation but decreases the TRPV4 amount in the plasma membrane.172 It was shown that this ubiquitination took place at the TRPV4 N-terminus and not the C-terminus by overexpressing the respective FLAG-tagged cytosolic TRPV4 domain along with ITCH in HEK293T cells with subsequent western blotting of the cell lysates against FLAG and ubiquitin. As ITCH harbors four WW domains which are hypothetically able to interact with the TRPV4 PRR, these results suggested a direct interaction between ITCH and TRPV4, even though the cell lysate could have provided additionally required adaptor proteins for a proper PPI between ITCH and the TRPV4 N-terminus. Shukla et al. showed a β-arrestin 1 mediated ubiquitination and functional down-regulation of TRPV4 via an angiotensin I mediated AT1aR activation in HEK293T cells, indicating that β-arrestin 1 is required for a GPCR-regulated ITCH- mediated TRPV4 ubiquitination.173 To investigate a possible direct interaction between ITCH and the human TRPV4 N-terminus (hsV4N) in vitro, recombinantly expressed human full-length ITCH was successfully purified for the first time to date (see figure 4.23 and subsection 3.7.7). To distinguish possible mini- mal binding sites within hsV4N, hsV4N ARD and hsV4N ARD with the PRR (hsV4 ARD-PRR) were also recombinantly expressed and purified (see subsection 3.7.1 and 3.7.2). All proteins showed expected molecular weights and secondary structures determined by CD spectroscopy Figure 4.23 (facing page): Purification of recombinant TRPV4 N-terminal constructs and human ITCH. A Topology model of recombinantly expressed TRPV4 N-terminal constructs and human ITCH. His6 = hexa-histidine tag (single letter code: HHHHHH), TEV = Tobacco Etch Virus Cleavage Site (single letter code: ENLYFQG), C2 = C2 domain, WW1+2 = WW domains 1 and 2, WW3+2 = WW domains 3 and 4, HECT = homologous to E6-AP C-terminus domain. His6-tags with preceding or subsequent TEV Cleveage Site were removed. B SEC purification of full-length human ITCH. C SEC purifications of TRPV4 N-terminal constructs and ITCH. SEC runs were performed with either a HiLoad Superdex 200 or a HiLoad Superdex 75 pg preparative SEC column. Inlets show Coomassie stained 15 % SDS-PAGEs of collected and concentrated fractions after SEC. x-axis: eluted volume in mL, y-axis: absorbance at 280 nm, M = marker. D Far UV CD spectrum of full-length human ITCH. E Comparison of far UV CD spectra of purified TRPV4 N-terminal constructs. Spectra were measured at 293 K and proteins were used at 1µM concentration in either SEC Buffer with a final NaCl concentration of 30 mM (TRPV4 N-terminal constructs) or ITCH SEC buffer with a final concentration of 20 mM NaCl (ITCH). Inlets show secondary structure prediction performed with CAPITO.93 The predicted α- helix/β-sheet/random coil content of the purified proteins is for hsV4N 53 %/0 %/.47 %,hsV4 ARD-PRR 60 %/0 %/ 40 %, hsV4 ARD 68 %/0 %/32 % and ITCH 29 %/20 %/51 %. x-axis: mean residue ellipticity ([Θ]mrw,λ) in 10−3 deg cm2 dmol−1, y-axis: wavelength λ in nm. 126 Chapter 4. Results A 1 5 99 326 391 438 511 569 903 ITCH N His6 TEV WW WW C2 HECT 1+2 3+4 C 1 136 146 149 398 hsV4N N PBD PRR ARD His6 C hsV4 ARD-PRR N PRR ARD His6 C hsV4 ARD N ARD His6 C B C 350 350 hsV4 ARD-PRR M ITCH M [kDa] Coomassie hsV4 ARD Coomassie [kDa] 250 150 300 150 300 100 75 100 75 ITCH 250 50 250 50 37 200 200 37 25 150 150 25 Superdex75 15 15 100 100 4NV sV 4 RR sV 4 hs h -P h RD Superdex200 50 AR D A 50 0 0 40 50 60 70 80 90 100 40 50 60 70 80 90 100 Volume [mL] Volume [mL] D E 1 .0 1 .0random coil 60 random coil 140 b-sheet hsV4N b-sheetITCH 0 .9 0 .9a-helix 0 .8 hsV4 ARD-PRR a-helix 0 .8 120 0 .7 hsV4 ARD 0 .7 100 0 .6 0 .6 40 0 .5 0 .5 80 0 .4 0 .4 60 0 .3 0 .3 0 .2 0 .2 40 0 .1 20 0 .1 20 0 .0 0 .0 TC H N 4 I V4 sV 4 RR V s h -P h s D 0 h D AR AR -20 0 -40 -60 -80 -20 -100 -120 -140 -40 200 210 220 230 240 250 260 200 210 220 230 240 250 260 l [nm] l [nm] 127 Abs [mAu] 280nm 3 2 -1 q [10 deg cm dmol ] mrw, l sec. structure content q [10 deg cm dmol ] Abs [mAu] mrw, l 280nm sec. structure content Chapter 4. Results (see figures 4.23 A-E). The topology model in figure 4.23 A shows the domains full-length ITCH is harboring. Besides the already mentioned WW-domains, ITCH consists of a C2 and catalyti- cally active HECT (homologous to E6-AP C-terminus) domain. C2 domains bind phospholipids for (plasma) membrane localization, either in Ca2+ dependent or Ca2+ independent manner, depending on the C2 domain family.174 The catalytic HECT domain interacts with E2 ligases to obtain ubqiquitin via trans-thioesterification and ultimately carries out the ubiquitination of substrate proteins.174,175 Zhu et al. provided the until to date only near-full length structure of ITCH via X-ray crystallography. However, the murine construct is lacking the N-terminal C2 domain (∆C2-ITCH) and WW3+4 are not resolved (PDB:5XMC).175 Nevertheless, this murine ∆C2-ITCH structure is consistent with individual resolved structures of WW1+2 and HECT do- mains. The structure of Zhu et al., combined with several resolved structures of the isolated domains, revealed an overall α-helical fold for the HECT domain, whereas the C2 and WW do- mains exhibit β-sheet folds.175–177 Enzymatic activity of purified ITCH was shown in an in vitro- ubiquitination assay (figure 4.25 A). The putative complex formation between ITCH and respec- tive TRPV4 N-terminal construct was probed via Blue-native PAGE (BN-PAGE). For hsV4N a complex at approx.150 kDa could be observed, which corresponds to an ITCH (approx.100 kDa)- hsV4N (approx.50 kDa) complex with a stoichiometry of 1:1. To confirm this, respective band was cut out (figure 4.24 B, red square) and mass spectrometric measurements were carried out (Johns Hopkins Mass Spectrometry and Proteomics Facility), confirming the presence of both proteins in indicated band. These results show that ITCH physically interacts with hsV4N, but not with hsV4 ARD and hsV4 ARD-PRR. Cross-link mass spectrometry (XL-MS) measure- ments with hsV4N and ITCH confirmed this direct PPI and also hint towards the requirement of full hsV4N for the interaction with ITCH (figure 4.24 C). Surprisingly, no lysine residues between hsV4N and the ITCH HECT domain were cross-linked. The ITCH HECT domain harbors the enzymatic activity site to receive ubiquitin from E2 ligases and to transfer this ubiquitin via trans- thioesterification to the target protein.178,179 Also, no cross-links between the hsV4N PRR and ITCH were detected, underlining the results of shown BN-PAGE results, that the full hsV4N is involved in the PPI (figure 4.24). To determine if ITCH is also able to ubiquitinate hsV4N in vitro, an ubiquitination assay with subsequent SDS-PAGE and Coomassie staining was performed with ITCH and respective hsV4N constructs (figure 4.25). 128 Chapter 4. Results A B + + c LA G G yc c m LA G A y AGc L R RRy m 4- F m R H- -F y -Fm 4 H- -F L P -P H- - V C 4 - V C 4 D D + + D + D S T P TC R I T PV M TC H RP IT P V R AR H H ARA H R G I T TR [kDa] I T R 4 N 4 M C N C 4 A +T CH sV sV 4 V ST T s I sV 4 IT C T h h h G [kDa] h hs V IT V4 H I hs C IT 100 75 250 100 150 75 100 100 50 75 100 75 Input (5 %) co-IP (a-myc) Pure proteins Protein mixtures C 1 5 99 326 391 438 511 569 903 WW WW ITCH N C2 HECT1+2 3+4 C 1 149 398 = lysine residue hsV4N N PBD PRR ARD His6 C Figure 4.24: ITCH and hsV4N are direct interaction partners. A α-myc immunoprecipitation of ITCH-myc shows co-immunoprecipitation of TRPV4-FLAG co-transfected in HEK293T cells and confirms ITCH as a part of the TRPV4 interactome172,173B Blue-native PAGE with purified TRPV4 N-terminal constructs and ITCH (see figure 4.23) shows complex formation at approx. 150 kDa (red square) between ITCH and hsV4N, confirmed by mass-spectrometric measurements.C Cross- link mass spectrometry (XL-MS) confirms a direct interaction between ITCH and hsV4N. Green bars indicate native lysine residues, whereas lysine residues involved in DSS-mediated cross-linking are additionally numbered. Black lines show cross-links between respective lysine residues. XL-MS measurements were kindly carried out by M.Sc. , University of Konstanz) At time point 60 min a band of approx.10 kDa (figure 4.25 A, red square) above the unmodified hsV4N band was observed, indicating an ubiquitination as ubiquitin has a molecular weight of 8.6 kDa. For better visualization, the time point 90 min is also shown. hsV4 ARD and hsV4 ARD-PRR showed no higher molecular weight bands and therefore no ubiquitination. For sub- sequent mass spectrometric identification of hsV4N ubiquitinaton sites, the red squared band after 60 min was cut out to rule out time-dependent unspecific ubiquitinations, as this was the earliest time point with a visible band for modified hsV4N. Four lysine residues in the intrinsi- cally disordered region (IDR) of hsV4N were identified as ubiquitination sites: K77, K101, K130 and K136. The IDR alone includes 11 lysine residues and the whole hsV4N a total of 23 ly- sine residues, depicting a high lysine specificity of ITCH-mediated ubiquitination. As mentioned above, ubiquitin has a molecular weight of 8.6 kDa. 129 34 70 211 a-myc, a-myc, a-FLAG, a-FLAG, 2 min 30 sec 2 min 30 sec 251 350 478 529 555 Chapter 4. Results A RR RR R R RR RR D D- P P P P P R R RD D - D D- D - - A A A AR AR AR AR AR D RD RD 4 4 4N 4 4 4N 4 4 4N 4 4 4N M A A N sV V V 4 4 4 h hs hs hs V sV V V V V V V Vh hs hs hs hs hs hs hs [kDa] hs V V hs hs V 100 ITCH 75 50 37 25 20 15 Ubiquitin 10 t [min] 0 15 30 60 90 B C N K77 K101 PRR PBD K136 K130 ARD PDB: 4DX1 = ubiquitinated lysine residue = non-ubiquitinated lysine residue Figure 4.25: ITCH ubiquitinates hsV4N directly. A In vitro ubiquitination assay shows ubiquitination of hsV4N by ITCH, indicated by the bands in red squares at time points 60 min and 90 min. The band at time point 60 min was cut out and supplied to mass spectrometric detection for ubiquitination (Johns Hopkins Mass Spectrometry and Proteomics Facility). See subsection 3.10.3 for a protocol of the assay. B Mass spectrometry revealed the direct ubiquitination of four lysine residues (K77, K101, K130 and K136) in the hsV4 IDR by ITCH, indicated by green bars. Therefore, hsV4N is present in a monoubiquitinated state in this assay, where each of above mentioned lysine residues is ubiquitinated once, respectively. The detected relative abundances of respective monoubiquitinated lysine harboring peptides decrease from K101>K77>K136>K130 (see section 6.7). Monoubiquination does not target proteins for proteosomal degradation, but rather serves as a signal for membrane trafficking and endocytosis.172,180,181 These find- ings also underline the results of Wegierski et al., who determined TRPV4 to be rather multi- than polyubiquitinated.172 Furthermore it was shown that the amount of internalized TRPV4 in- creased in the presence of ITCH, suggesting an increased ITCH-mediated TRPV4-endocytosis via monoubiquitination.172,173 But why is there no HECT-hsV4N IDR interaction in the shown XL-MS data in figure 4.24 C? 130 Chapter 4. Results A 1 5 99 326 359 391 419 438 511 569 903 WW WW WW WW hsITCH N C2 HECT1 2 2L 3+4 C = lysine residue B WW2 HECT mm K311 hs K350 WW2L mm C832 hs C871 N PDB: 5XMC Figure 4.26: Cross-link mass spectrometry (XL-MS) measurements showing inter- and/or intramolecular interactions be- tween ITCH molecules. A Topology model of full-length human ITCH with respective inter- and/or intramolecular self-crosslinks of ITCH. Green bars indicate native lysine residues, whereas lysine residues involved in DSS-mediated cross-linking are additionally numbered. Dark arches show cross-links between respective lysine residues. XL-MS measurements were kindly carried out by M. Sc. Jasmin Jansen (Working group Stengel, University of Konstanz).B Crystal structure of autoinhibited mouse ITCH (mmITCH) (PDB:5XMC). For better comparison with the used human constructs in this theses, highlighted residues are indicated for mouse (mm) with the corresponding human (hs) residue below. lysine residues are indicated as light green spheres. Mouse cysteine 832 (mm C832) is shown as yellow sphere, indicating the position of the catalytic active site for ubiquitin transthiolation in the HECT domain. The structure here is lacking the C2 domain, furthermore the WW3 and 4 domains were not resolved. The only structurally resolved lysine in shown murinal structure which is involved in cross-links shown in A mouse lysine 311 (mm K311),which is the corresponding lysine for human lysine 350 (hs K350).175 It is known that HECT E3 ligases like ITCH exist in an autoinhibited state.175,179 In this au- toinhibited state, the WW2 domain and a part of the linker region connecting WW2 and WW3 (referred as WW2L) bind to a hydrophobic surface opposite to the catalytic active site of the ITCH HECT domain, therefore allosterically locking the HECT domain in an inactive state (fig- ure 4.26 A). However, binding of the ITCH interaction partner Ndfip1 to the ITCH WW2 domain releases ITCH out of its autoinhibited state.175 The XL-MS data thus could represent the initi- ation step of the ITCH-hsV4N interaction, where hsV4N releases ITCH out of its autoinhibitory state and ITCH would be ready to receive an ubiquitin from an E2 ligase in its HECT domain. The presence of ITCH in this autoinhibited state could not be determined via self-link (inter- or intramolecular between ITCH) XL-MS data (figure 4.26), as the WW2 domain and WW2L does not harbor any lysine residues which could have been cross-linked to lysine residues in the 131 56 211 249 350 478 513 251 Chapter 4. Results HECT domain. Furthermore, neither in intermolecular cross-links between hsV4N and ITCH (figure 4.24 C) nor in self-linked cross-links between or within ITCH (see 4.26 B) any HECT lysine participated in cross-linking. This could be due to the location of most HECT lysine residues, as they are buried in the N- and C-lobe of the HECT domain and therefore are un- reachable for DSS for cross-linking (figure 4.26 B). Ubiquitin binding itself leads to dramatic conformational changes in the HECT domain. HECT domains consists of a so-called N- and C-lobe, with the C-lobe harboring the catalytically active site. These lobes change their overall orientation from a "closed" T-shape to an "open" L-shape upon ubiquitin binding, enabled via a flexible hinge region between the two lobes. Therefore the data suggests, that hsV4N probably releases ITCH from its autoinhibited state, enabling ubiquitin binding to the HECT domain via an E2 ligase. Due to the ubiquitin-binding, the HECT domain changes from a "closed" T-shape to an "open" L-shape, enabling an interaction of the hsV4N IDR with the HECT domain for IDR ubiquitination.182 Interestingly, two of the ubiquitinated TRPV4 lysine residues are in close proximity to the pro- line rich region (PRR, K136) and the phosphoinositide-binding domain (PBD, K130) of hsV4N, two important regulatory sites in TRPV4. These modifications could thus lead to an altered binding behavior between hsV4N and other proteins, for example, between PACSIN3 and the TRPV4 PRR. As already described in section 4.3, co-expression of PACSIN 1 and 3, respec- tively, with TRPV4 lead to a dampened hypoosmolarity induced TRPV4-mediated Ca2+-influx in HEK293T cells (figure 4.16). Furthermore, it was shown that the presence of PACSIN3 in- creases the plasma membrane amount of TRPV4 by probably inhibiting endocytosis, whereas ITCH decreases the TRPV4 amount in the plasma membrane via endocytosis.70,172 Here, two different regulating mechanisms lead to a decreased basal TRPV4 activity. The ubiquitination close to the TRPV4 PRR thus could therefore be a regulating switch between these two mech- anisms: whereas PACSIN3 could provide a transient and fast TRPV4 desensitization, ITCH could disrupt this interaction via the K130 and K136 monoubiquitinations, therefore sterically hindering the PACSIN3 SH3 domain to interact with the TRPV4 PRR. This then could lead to a TRPV4 endocytosis, serving a TRPV4 "inactivation" for a longer time range.172 Furthermore, the monoubiquination of K136 next to the PBD could lead to an impaired TRPV4-PIP2 interac- tion, resulting in an altered TRPV4 regulation. Opposite consequences for the TRPV4 activity were shown upon PIP2 binding, pointing out the need for further investigations of the conse- quences of TRPV4-lipid interactions.39,183,184 Goretzki et al. showed via elaborate and comprehensive biophysical studies a structural and dynamic coupling between the TRPV4 IDR and ARD.23 Consequently, comparably large post- 132 Chapter 4. Results translational modifications (PTMs) in the TRPV4 IDR could thus lead to modified interactions with the TRPV4 ARD with impacts on ARD-mediated PPIs, for example. The results shown here therefore contribute to a further understanding of the PPI between hsV4N and ITCH. 133 Chapter 4. Results 4.6 TRPV4 and the actin cytoskeleton - connecting scientific disciplines In preceding MS studies of the hsV4N interactome, conducted in the authors master thesis, a possible Ca2+-dependent interaction between smooth muscle α-actin and hsV4N was ob- served, where α-actin amounts were higher in the samples with Ca2+-supplementation.76 This findings were especially intriguing, as TRPV4 is known to influence the microtubule and actin cy- toskeleton, with consequences for cell stiffness, migratory behavior and morphogenesis.185–187 Goswami et al. showed a direct interaction between the TRPV4 C-terminus and actin in co- sedimentation assays, but left out hsV4N in these studies due to expression problems. There- fore, Goswami et al. argue that hsV4N could also play an important regulatory role in the shown colocalization between TRPV4-GFP and F-actin in transiently transfected F11 cells.185 This possible cytoskeletal mediating role of hsV4N is underlined by the direct interaction between hsV4 ARD and the small GTPase RhoA shown in this thesis (section 4.4). RhoA is a prominent cytoskeleton regulator, playing a key role in stress fiber formation and actin polymerization.166,167,169. As a starting point to elucidate the role of hsV4N in actin regulation, the potential Ca2+-dependent colocalization between the actin cytoskeleton and TRPV4 was investigated with fluorescence microscopy. HEK293 cells stably expressing human TRPV4-cGFP were treated either with 200 nM HC067 (TRPV4 antagonist) for 15 min at 37 °C, 30 nM GSK-101 for 1 min at 37 °C or left at 37 °C for 15 min without any supplementation. F-actin was visualized by subsequent phalloidin-TRITC staining (figure 4.27, for full immunostaining procedure see section 3.3). Although plenty of colocalization programs are available, either as ImageJ plugins or as com- mercial softwares, the algorithms and parameters of these programs are poorly described.188 Furthermore, most of the programs do not provide automated image analysis, making statistical evaluations of colocalization quantification tedious and time-consuming. To circumvent the us- age of "black box" programs and to provide large-scale image analysis, the theoretical chemist B. Sc. joined this project to contribute an in-house software for colocaliza- tion studies: ELSEXY, short for Efficient Large Scale Evaluation of cross(X)-correlation Yields. Figure 4.27 shows representative fluorescence images of stably transfected HEK293 cells ex- pressing hsTRPV4-cGFP after various treatments. 134 Chapter 4. Results 135 hsTRPV4-cGFP F-actin Merge DAPI Figure 4.27: Fluorescence microscopy images reveal stress fiber formation upon TRPV4 activation in stably transfected HEK293 cells. Stress fiber formation was especially pronounced upon treatment with 30 nM GSK-101 for 1 min at 37 °C, with clearly visible dorsal and ventral stress fibers as well as transverse arcs, whereas only temperature activation of TRPV4 at 37 °C lead to a milder phenotype with some ventral stress fibers visible. Treatment with 200 nM of the TRPV4 antagonist HC-067 for 15 min at 37 °C showed no stress fiber development. F-actin was visualized via phalloidin-TRITC staining (see section 3.3). Scale bar = 10µm. Images were taken with a Zeiss Axio Observer Z1 inverted widefield microscope. HC-067 Temp. [37 °C] GSK-101 Chapter 4. Results Upon chemical compound activation with the potent TRPV4 activator GSK1016790A (GSK- 101), cells showed explicit stress fiber formation, hinting towards a hsV4N involvement in cellular actin reassembly, as hsV4 ARD was shown to directly interact with inactive GDP- bound RhoA, the key regulator of stress fibers in cells (see section4.4).166,167,169 TRPV4 ac- tivation activates RhoA, leading to a loss-of-interaction between TRPV4 and RhoA.69 Activated, GTP-bound RhoA then mediates stress fiber formation by downstream interactors like ROCK and mDIA1.166 The mild stress fiber phenotype of cells after TRPV4 temperature activation hints towards a Ca2+- GFP and TRITC concentration dependency GSK-101 MGFP of stress fiber formation, GSK-101 MTRITC as more physiological stim- HC-067 MGFP uli lead to lower amount of HC-067 MTRITC Ca2+-influx compared to Temp. MGFP GSK-101 treatment (see Temp. MTRITC also section 4.3, figure 0 20 40 60 80 100 % 4.16). To determine 2+ Figure 4.28: Calculated M-values of GFP (TRPV4-cGFP) and TRITC (F-actin stainedif TRPV4-mediated Ca with Phalloidin-TRITC) images show decreased TRPV4 and F-actin colocalization influx leads to an in- upon TRPV4-mediated Ca2+-influx in HEK293 cells. For description of M-values see equation 4.4 and corresponding text. Box plot whiskers indicate values inside 1.5-fold in- creased TRPV4-actin colo- terquartile range, green diamonds the arithmetic mean. Notches show 95 % confidence calization, fluorescence im- intervall of mode. Outliers are shown as circles. nGSK-101=18, nHC-067=28, nTemp=33. ages were subjected to ELSEXY. Shortly described, after hot-pixel and non-uniform background correction, ELSEXY calculates the Pearson Colocalization Coefficient (PCC) r of subjected fluorescence images ( figure 6.8). The PCC is a measure for the linear dependency of two measured values. To obtain the PCC of the here obtained imgages, the measured values here are the fluorescence intensities of a pair of corresponding pixels in two fluorescence microscopy images (IA and IB, see equation 4.3).189 = √ IA × IB − I × Ir A BA,B (4.3) (I2A − 2 2 I 2A ) × (IB − IB ) Due to this linear dependency, the PCC not always perfectly describes the probable colocal- ization in two images. Additionally, so-called M-values can improve the colocalization quan- tification, by calculating the fraction of colocalized intensities. This is conducted by defining thresholds for intensities. Pixel intensities above the defined thresholds in respective images 136 Chapter 4. Results are considered as colocalized. These thresholds (TA, TB) result from a limit intensity (Ilim) dependent evaluation of the PCC for pixels which are smaller than Ilim. M-values thereby depend on the PCC r, as the thresholds depend on each other, shown in equation 4.4.189 ∑ MA = IA>T∑A∧IB>TB (4.4) IA with IB = m · IB + b. Statistical evaluation of the colocalization between hsTRPV4-cGFP and F-actin via phalloidin- TRITC with ELSEXY showed a decreased colocalization upon TRPV4-mediated Ca2+-influx (figure 4.28 and also see figures 6.9 for negative controls). These results seem to op- pose the above mentioned increased actin-levels detected in hsV4N MS samples upon Ca2+- supplementation.76 One possible explanation could serve the sample preparation for subse- quent MS experiments conducted by Diehl et al., which differ from the protocol conducted in this work (section 3.8). Whereas in the present work a digitonin solution was used to release cytosolic proteins into the supernatant of dish-cultured HEK293 cells, the previous protocol in- cluded whole-cell lysis of HEK293 cells with a CHAPS-containing buffer. It was shown that detergents like CHAPS lead to actin depolymerization from F-actin to G-actin, therefore hinting towards the possibility that G-actin binds in a Ca2+-dependent manner to hsV4N.190 This hy- pothesis is underlined by the results of Becker et al. who showed that the TRPV4 C-terminus is also capable of binding G-actin in co-sedimentation assays.185 The possible interaction be- tween G-actin and hsV4N could represent a regulatory loop between TRPV4, RhoA and F-actin. TRPV4 activation leads to a reduced binding of RhoA to hsV4 ARD and activation of RhoA via GTP binding.69 RhoA activation leads ultimately to stress fiber formation, while G-actin possibly now interacts with hsV4N. In the course of this work it was tried to clone a TRPV4 construct lack- ing the C-terminus to determine if only hsV4N is responsible for stress fiber formation via RhoA, but until to this date, the cloning was not successful. However, above mentioned experimental set-ups should be conducted to get a more detailed view on the hsV4N-actin interaction. Overall it could be shown that different TRPV4 activators lead to Ca2+ concentration dependent stress fiber formation in stably TRPV4-cGFP transfected HEK293 cells. Furthermore, the in house software ELSEXY generated preliminary Ca2+-dependent colocalization data between TRPV4- cGFP and F-actin. However, ELSEXY is still in the refinement process and will give raise to a comprehensive, high-throughput colocalization studies in the future. 137 Chapter 5. Conclusion & Outlook 5 Conclusion & Outlook Meeting at the hot-spot of disease causing TRPV4 mutations - the TRPV4 ARD and its interaction partners DDX3X and RhoA Inada et al. proposed altered tissue-specific protein-protein interactions (PPIs) as a reason for the disease pathology and tissue specificity of respective TRPV4 mutations.27 First results in this thesis underline before mentioned hypothesis by showing both, increased and abolished PPIs between TRPV4 harboring neuropathy-causing mutations and several cytosolic proteins. CMT2C-causing TRPV4 R232C showed increased interaction with DDX3X compared to TRPV4 wt in vitro and in cellulo, leading to decreased dxRNA-stimulated ATP-hydrolysis of DDX3X upon this interaction in vitro (see sections 4.1 and 4.2). This altered PPI is particularly in- teresting, as mutations leading to ATP-hydrolysis deficiency in DDX3X are connected to the emergence of medulloblastoma, a rapidly growing and metastasizing form of infant cerebellum tumor, and can be the cause of so-called X-linked intellectual development disorder Snijder Broks type (MRXSSB, OMIM: 300958). MRXSSB patients show a spectrum of neuropathologi- cal symptoms, but the most shared among patients are muscle hypotonia, movement disorders and aberrant intellectual development.139,191–195 These symptoms, especially the intellectual disability, hint towards a pivotal role of DDX3X in neuronal fetal development of the central ner- vous system (CNS). DDX3X mutations were shown to affect CNS neurogenesis during fetal development of the cerebral cortex. Additionally, it was shown that DDX3X plays a role in the in- duction of the neuronal crest during fetal development, the progenitor structure from which the peripheral nervous systems (PNS) develops from.196 TRPV4-associated neuropathies affect the PNS, underlining the possible key role of the TRPV4-DDX3X interaction in PNS develop- ment and maintenance and ultimately pathological consequences due to a TRPV4 mutation induced aberrant TRPV4-DDX3X PPI, probably leading to stress granule (SG) hyperassembly in the PNS.31,137,197 Pharmacological inhibition of ATP-hydrolysis or RNA-helicase activity in DDX3X via the small 138 Chapter 5. Conclusion & Outlook molecules RK-33 or D16, respectively, showed diminished SG assembly upon arsenite induced oxidative stress in UO2S cells. Already formed SGs upon stress treatment showed no altered disassembly behavior upon RK-33 or D16 treatment, respectively.117 Especially regarding the ATP hydrolysis inhibition, these findings seem to contradict the results of Valentin-Vega et al. and in this thesis, indicating that impaired DDX3X ATP hydrolysis, either due to DDX3X mu- tations or altered PPIs, spur SG assembly.119 Yang et al. confirmed direct binding of RK-33 to recombinant DDX3X (aa 1-508) with isothermal calorimetry (ITC) and proposed an impaired RK-33 interaction via the active site of ATP hydrolysis due to the depletion of RK-33 binding to DDX3X K230E in sedimentation velocity assays. This mutation resides within the DDX3X Walker A motif, which is essential for DDX3X’s ability to hydrolyze ATP.198 However, the ex- act binding mode of RK-33 to DDX3X still remains elusive and therefore the overall possible structural consequences within DDX3X upon RK-33 binding. Thus, disease-causing mutations which lead to impaired ATP hydrolysis in DDX3X still could be the cause of altered PPIs and subsequent SG hyperassemblies, while pharmacological ATP hydrolysis inhibition influences DDX3X in such a manner, that pathological SG-inducing PPIs are also impaired. To shed more light in the consequences between the here shown elevated TRPV4 R232C- DDX3X PPI, a multi-pronged approach should be performed. On one hand, NMR chemical shift perturbation assays, corresponding to the experiments in section 4.4 with hsV4 ARD and 15N-labled RhoA, should be conducted to gain detailed insights in the direct interaction be- tween DDX3X and hsV4 ARD and hsV4 ARD R232C, respectively. Furthermore, the influence of RK-33 on possible structural changes in DDX3X could be also investigated via NMR and com- pared to before mentioned NMR perturbation assays with hsV4 ARD and hsV4 ARD R232C to reveal possible difference in ATP hydrolysis inhibition via a PPI or a pharmacological inhibi- tion. Additional in vitro experiments should include further ATPase assays with ARDs of other TRP channels or even other protein superfamilies to distinguish if this interaction exclusively accounts for hsV4 ARD or also other ARDs. Furthermore, functional studies of DDX3X inter- action for TRPV4 should be conducted in cellulo via Ca2+-influx assays as shown in 4.3. To underline the hypothesis of SG hyperassembly due to aberrant TRPV4 R232C-DDX3X interac- tion, in cellulo experiments with transfected cells should be conducted to investigate a TRPV4 (R232C)-mediated influence upon stress granule formation with DDX3X participation via im- munofluorescence staining and subsequent microscopy, for example. Additionally, the binary TRPV4 PPIs shown in this thesis should be expanded into ternary and even quaternary PPI investigations. One starting point could be the possible ternary PPI be- tween TRPV4, DDX3X and RhoA. For both proteins, a direct interaction with hsV4 ARD was 139 Chapter 5. Conclusion & Outlook shown in this thesis. Furthermore it was shown that GSK-101 activation of TRPV4 wt in cel- lulo leads to a decreased PPI between TRPV4 and RhoA or DDX3X, respectively, shown by co-IPs.69,136 Furthermore, Phung et al. indicated a possible DDX3X-RhoA interplay by show- ing elevated levels of GTP-bound (active) RhoA in human liver cancer cell lines (HT-144 and A2058) upon DDX3X siRNA treatment, lowering but not depleting DDX3X levels in respective cell lines.199 In the course of this thesis, upon the presence of a neuropathy-causing mutation, DDX3X showed an increased TRPV4 PPI, whereas RhoA showed a decreased TRPV4 PPI. It should be noted that two different neuropathy-causing mutations were used (TRPV4 R232C with DDX3X and TRPV4 R269C with RhoA). Both mutations should be investigated in the con- text of the ternary TRPV4-DDX3X-RhoA interaction. Disorder matters - PPIs of the TRPV4 N-terminus underlines the pivotal role of the intrinsically disordered region Another possible ternary PPI which could be relevant in the context of neuropathy-causing TRPV4 mutations includes TRPV4, PACSIN1 and ITCH. In this thesis it was shown that ITCH directly interacts with only the full TRPV4 N-terminus (hsV4N), but not with the TRPV4 ankyrin repeat domain (hsV4 ARD) or hsV4 ARD with the preceding proline rich region (hsV4 ARD- PRR). Furthermore it was shown, that ITCH ubiquitinates four distinct lysines in the intrinsically disordered region (IDR) of hsV4N (K77, K101, K130 and K136, see section 4.5). This is partic- ularly interesting, as such post-translational modifications (PTMs) could interfere with possible TRPV4 PPIs. With regard of the known interaction of PACSIN SH3 domains with the TRPV4 PRR (aa 136-144), ubiquitination of lysines K130 and K136 are especially interesting with re- gard to possible disrupted PACSIN1/3 interactions with the TRPV4 PRR due to steric hindrance after ubiquitination of respective lysine. But also, interaction of PACSIN1/3 could prevent TRPV4 IDR ubiquitination, resulting in two different regulating mechanism leading to a decreased basal TRPV4 activity (see section 4.5). Desrochers et al. furthermore showed that the PACSIN1 SH3 domain interacts with the ITCH PRR located between the C2 and WW1 domain (aa 252 - 267). With the shown loss-of-interaction between PACSIN1 and TRPV4 harboring the neuropathy- causing R269C mutation with vanished TRPV4-mediated Ca2+-influx dampening by PACSIN1 as a consequence in cellulo (see section 4.3), this loss-of-interaction could also lead to an in- creased interaction between PACSIN1 and ITCH in neurons. The physiological consequences of this interaction still remain elusive, but one scenario could be an impaired interaction of ITCH with other proteins - TRPV4 for example. Due to the location of the ITCH PRR between two other 140 Chapter 5. Conclusion & Outlook important regulatory domains, namely the ITCH C2 domain and the ITCH WW1 domain, inter- action with PACSIN1 could therefore impair possible interactions of at least these two domains, hypothetically impairing plasma membrane localization via the ITCH C2 domain and other PPIs of the ITCH WW1 domain, if not also of the other WW domains regarding the compact struc- ture of ITCH in its autoinhibited state (shown in figure 4.26 B). As ITCH is known to mediate TRPV4 endocytosis, a loss of interaction between PACSIN1 and TRPV4 R269C could there- fore induce a vicious cycle where PACSIN1 and ITCH-mediated negative TRPV4 regulation are both abolished. This would lead then to elevated neurotoxic Ca2+ levels due to the elevated basal Ca2+ influx activity of this TRPV4 mutation (see also figure 4.17) in addition to the here showed lost interaction between TRPV4 R269C and RhoA with the cytoskeletal consequences (see 4.4).53,69 Neuropathy mutant TRPV4 TRPV4 extracellular plasma membrane intracellular ARD ITCH ITCH x RhoA PR PR RhoA RR x PACSIN1 PACSIN1 DDX3X DDX3X N N = increased interaction = interacts with x = abolished interaction Figure 5.1: Tissue specificity of neuropathy-causing TRPV4 mutations occur due to aberrant tissue specific protein- protein interactions Schematic representation of how TRPV4 neuropathy mutations lead to aberrant protein-protein interactions investigated in the course of this thesis. It was shown that RhoA and DDX3X specifically interact with the a-helical TRPV4 ankyrin repeat domain (ARD), whereas PACSIN1 is known to interact with the TRPV4 proline rich (PRR) region within the unstructured intrinsically disordered region (IDR) and ITCH requires the full TRPV4 N-terminus, with a possible interaction with the TRPV4 PRR.22,69 In the presence of a neuropathy-causing TRPV4 mutation the interactions with RhoA and PACSIN1 are abolished, with a possible consequence for the ITCH-TRPV4 interaction due to a putative increased PACSIN1-ITCH interaction. An increased interaction between neuropathy mutant TRPV4 and DDX3X was also shown in this thesis. To elucidate this, co-IPs with cells transfected with TRPV4 (R269C), ITCH and PACSIN1 should be conducted to investigate the proposed binding competition between ITCH and PACSIN1 to TRPV4. After getting details of the interaction between ITCH and TRPV4, either with NMR stud- ies including the ITCH WW domains and a peptide including the TRPV4 PRR or via cryo-EM with full length ITCH and hsV4N, latter experiment should be complemented with the TRPV4 141 Chapter 5. Conclusion & Outlook R269C mutation. If both before mentioned methods should not be applicable, XL-MS studies could be conducted including hsV4N R269C with ITCH and PACSIN1, respectively, to get a detailed insight into the mutation-dependent altered PPIs. With the comprehensive interactome study shown in this thesis, future investigations should further validate the identified putative TRPV4 interactors shown in section 4.1, especially con- sidering the proposed role of TRPV4 in cytoplasmic granule and/or stress granule formation via its cytosolic N-terminus. Co-IPs with cells transfected with (mutated) TRPV4 and other here detected prominent SG formation proteins like TIA-1 and IGF2BP2 (figure 4.6) should be con- ducted, as well a possible TRPV4 mediation of altered stress granule formations under stress conditions in cellulo. 142 Chapter 6. Appendix 6 Appendix 6.1 Appendix - Introduction CUL1 PACS2 KIF3A KIF3B EIF2AK3 STX5 RP2 HAVCR1 TNNI3 Ă-Trcp1 ID2 TNNI1 CBY1 HDAC6ā-actinin-2 eIF2ā TNNI2 PCNT PIEZO1 Ă-Trcp2 ă-adaptin TPM1 PSMD7 PKD1L1 TRPP1 TRPP2 PKD1L3 FLNA IFT57 CD2AP GJA1 NEK8 TRPP PHB2 DIAPH1 HAX1 ā-actinin-1 VCP TRPP3 TJP1 VASP WWTR1 CABP1 MDFI Gz-ā HERPUD1 āII-spectrin SLC25A4SLC8A1 DPYSL2 CALR ANXA1 EPB41 GRM1 CTTN PKHD1 RyR ATP2A2 ITPR1Gāi2 JPH2 PLCă2 TRPM6 HOMER1 MARCKS DRD2 PKD1ā-actinin PLCĄ1 ORAI3 PLCĂ3DMD FKBP5 RYR1 CAV3 ATP2B1 VAMP RNF24 WNK4 RHOA GAP43 āSNAP ATP2A3 ITPR2 TRPM7 ĂV-spectrin HOMER2 ITPR3 NYX HOMER3 TRPC7 ăENaCRYR2 SLC2A4 TRPM TRPC NCS1 ORAI2 RTP1 SLC9A3R1 TRPC4 UBC STIM2 TRPC3 GNB2L1 CSNK1A1 SESTD1 EZR CDH5 MYH10 TRPC1 SNAP23 GPR179 CaMKIIĂ LYNTRPC5 SYPL2 MYH9MX1 TRPC2 PRKCSH PLCĂ1 PACS1 ABCC8 PRKG1 ASPH TRPM4 SHANK TARBP2 Gāq/11 FKBP1A SYN1 TRPM1 SLC9A3R2 Gāi3 CAV1 ă-actin DYNC1H1 CASP4 VAMP2 CDH1 ā2-integrin CACNA1C CASR STIM1 SRC SYT1 P2RX3 14-3-3ă ENKUR DBN1ā1-syntrophin STMN1 SNAP25 EPOR MAP7 NPR1 STX3SNAPIN TRPC6 ITCH CLTC Homer PDE3A HCK AGTR1 CASP1 TRPV4PPP3CA FYN KCNMA1EGFR STMN4 STMN2 FKBP4 ORAI1 LCK NKAā1 CALM1 Ă-catenin Ă-arrestin AQP2 PKCĂ TRPM3 NTRK2 Ă-tubulin-5 STMN3 SNF8 SYT4 ā-tubulin-1A DNM1 PI3K-p85Ă FGFR1 PPIB S100A10 TTRRPPAA11 AQP5 Tubulin PRKACA YES1 OS9 NPHS2 ANO1 CHRM1 CaMKII NPHS1 PTPN1 KCNQ2 PACSIN1 PACSIN3 TRPV3 GRIN2B RAB9A āENaCTRPV6 AQP4 TRPV5 PDZD3 TRPV1 ā-tubulin-1B TRPML NIPSNAP1 PACSIN2 MAP3K7 HSPA8 CYLD CDK5 CALB1 PKCā Ă-tubulin-3RGS2 Akt PDCD6 AKAP5 NME1 SCG3 NOS3TRPV2 PKCą PRKD1/PKCĀCDC42 STIP1 PTEN KIF13B RAC2 BSPRY RAB11A CBL KL RAB11FIP3 PKC TRPML2 PKARIIā KvĂ2 DNAJC14 PEA15 TRPML3 NUMB KCNQ3 AMPKā2 CNR1 LAPTM4B TRPM2 TRPV PPARā NTRK1 FAF1 PI3K-p85ā YIF1B TPCN1 GABARAP PXMP2 TRPML1 LGALS1 TGM2 GRIN1 RAC1 PIRT TPCN2 LAPTM4A ACBD3Tmem185a STOML1 PTPN13 SYNE1 HSP90AA1 GABARAPL2 PIP5K1A SLC50A1PEX16 ERGIC3 (BAE) EFHC1 TRPM8 RHOG = human TMEM163 LAPTM5 SEC31A = mouse/rat OPRM1 HTR1B Gāq Figure 6.1: TRP channel PPI network extracted from the TRIP Database. The majority of the shown PPIs are with rodent proteins (grey nodes), whereas only a minority depicts PPIs with human proteins (purple nodes). Node colors of TRP subfamilies are indicated in the figure. Network was rendered with Cytoscape 3.8.0.29,30 143 Chapter 6. Appendix Table 6.1: List of human TRP channel protein interactors deposited in the TRIP database.29,30 Note, that not all TRP channels are represented, as the most experiments did not use human proteins for PPI investigations. TRP channel Protein interactor Experiment TRPC1 Calmodulin Fusion protein-pull down assay TRPC1 Caveolin-1 Fusion protein-pull down assay TRPC1 D2R Fusion protein-pull down assay TRPC1 FKBP52/FKBP4 Co-immunoprecipitation TRPC1 FKBP52/FKBP4 Fusion protein-pull down assay TRPC1 I-MFA Fusion protein-pull down assay TRPC1 NCS-1 Fusion protein-pull down assay TRPC1 TRPP1 Fusion protein-pull down assay TRPC3 Calmodulin Fusion protein-pull down assay TRPC3 FKBP12 Co-immunoprecipitation TRPC3 Homer-1 Fusion protein-pull down assay TRPC3 IP3R3 Fusion protein-pull down assay TRPC3 MxA Fusion protein-pull down assay TRPC3 NCX1 Fusion protein-pull down assay TRPC3 Orai1 Fusion protein-pull down assay TRPC3 TRPC1 Fusion protein-pull down assay TRPC3 TRPM4 Yeast two-hybrid TRPC4 αII-spectrin Fusion protein-pull down assay TRPC4 αII-spectrin Fusion protein-pull down assay TRPC4 D2R Fusion protein-pull down assay TRPC4 MxA Fusion protein-pull down assay TRPC4 NHERF1 Fusion protein-pull down assay TRPC5 D2R Fusion protein-pull down assay TRPC5 Gαqi3 Fusion protein-pull down assay TRPC5 MxA Fusion protein-pull down assay TRPC5 NCS-1 Yeast two-hybrid TRPC5 NCS-1 Fusion protein-pull down assay TRPC6 MxA Fusion protein-pull down assay TRPC7 MxA Fusion protein-pull down assay 144 Chapter 6. Appendix TRP channel Protein interactor Experiment TRPM3 Calmodulin Fluorescence probe labeling TRPM3 S100A10 Fluorescence probe labeling TRPM4 TRPC3 Yeast two-hybrid TRPM7 SNAPIN Fusion protein-pull down assay TRPM8 Gαq Fusion protein-pull down assay TRPML1 ALG-2/PDCD6 Fusion protein-pull down assay TRPML1 HSC70 Fusion protein-pull down assay TRPML1 HSP40/DNAJC14 Fusion protein-pull down assay TRPML1 LAPTM4a Yeast two-hybrid TRPML1 LAPTM4b Yeast two-hybrid TRPML1 LAPTM5 Yeast two-hybrid TRPML1 SEC31A Fusion protein-pull down assay TRPP1 ID2 Yeast two-hybrid TRPP1 KIF3A Yeast two-hybrid TRPP1 KIF3A Fusion protein-pull down assay TRPP1 KIF3B Fusion protein-pull down assay TRPP1 PACS-1 Fusion protein-pull down assay TRPP1 PACS-2 Fusion protein-pull down assay TRPP1 TRPP1 Yeast two-hybrid TRPP1 RyR2 Fusion protein-pull down assay TRPP1 Tropomyosin 1 Fusion protein-pull down assay TRPP1 Troponin I 3 Fusion protein-pull down assay TRPP1 TRPC1 Fusion protein-pull down assay TRPP2 α-actinin-1 Yeast two-hybrid TRPP2 α-actinin-1 Yeast two-hybrid TRPP2 α-actinin-2 Yeast two-hybrid TRPP2 α-actinin-2 Yeast two-hybrid TRPP2 Troponin I 1 Fusion protein-pull down assay TRPP2 Troponin I 2 Fusion protein-pull down assay TRPP2 Troponin I 3 Fusion protein-pull down assay TRPP3 RACK1 Fusion protein-pull down assay TRPV1 AKAP5/AKAP150 Fusion protein-pull down assay 145 Chapter 6. Appendix TRP channel Protein interactor Experiment TRPV4 Calmodulin Fusion protein-pull down assay Table 6.2: List of known TRPV4 interactors deposited in the TRIP database.29,30 TRP channel Protein interactor Experiment TRPV4 LYN Co-immunoprecipitation TRPV4 LYN Co-immunofluorescence staining TRPV4 LYN In vitro PTM assay TRPV4 LYN Calcium measurement TRPV4 SRC Co-immunoprecipitation TRPV4 SRC In vitro PTM assay TRPV4 SRC Calcium measurement TRPV4 FYN Co-immunoprecipitation TRPV4 FYN Co-immunoprecipitation TRPV4 FYN In vitro PTM assay TRPV4 FYN Calcium measurement TRPV4 HCK Co-immunoprecipitation TRPV4 HCK In vitro PTM assay TRPV4 HCK Calcium measurement TRPV4 LCK Co-immunoprecipitation TRPV4 LCK In vitro PTM assay TRPV4 LCK Calcium measurement TRPV4 YES Co-immunoprecipitation TRPV4 YES In vitro PTM assay TRPV4 YES Calcium measurement TRPV4 LYN Inference TRPV4 SRC Inference TRPV4 FYN Inference TRPV4 HCK Inference TRPV4 LCK Inference 146 Chapter 6. Appendix TRP channel Protein interactor Experiment TRPV4 YES Inference TRPV4 Calmodulin Fusion protein-pull down assay TRPV4 Calmodulin Fusion protein-pull down assay TRPV4 Calmodulin Fusion protein-pull down assay TRPV4 Calmodulin Patch clamp TRPV4 Calmodulin Inference TRPV4 MAP7 Yeast two-hybrid TRPV4 MAP7 Co-immunoprecipitation TRPV4 MAP7 Co-immunoprecipitation TRPV4 MAP7 Co-immunofluorescence staining TRPV4 MAP7 Co-immunofluorescence staining TRPV4 MAP7 Co-immunofluorescence staining TRPV4 MAP7 Cell surface biotinylation TRPV4 MAP7 Patch clamp TRPV4 PACS-1 Co-immunoprecipitation TRPV4 PACS-1 Co-immunoprecipitation TRPV4 PACS-1 Inference TRPV4 NHERF4 Inference TRPV4 AQP-5 Co-immunoprecipitation TRPV4 AQP-5 Co-immunoprecipitation TRPV4 AQP-5 Inference TRPV4 Pacsin1 Yeast two-hybrid TRPV4 Pacsin1 Co-immunoprecipitation TRPV4 Pacsin1 Co-immunoprecipitation TRPV4 Pacsin2 Inference TRPV4 Pacsin2 Co-immunoprecipitation TRPV4 Pacsin2 Co-immunoprecipitation TRPV4 Pacsin3 Yeast two-hybrid TRPV4 Pacsin3 Co-immunoprecipitation TRPV4 Pacsin3 Co-immunoprecipitation TRPV4 Pacsin3 Co-immunoprecipitation TRPV4 Pacsin3 Co-immunoprecipitation 147 Chapter 6. Appendix TRP channel Protein interactor Experiment TRPV4 Pacsin3 Co-immunofluorescence staining TRPV4 Pacsin3 Co-immunofluorescence staining TRPV4 Pacsin3 Co-immunofluorescence staining TRPV4 Pacsin3 Co-immunofluorescence staining TRPV4 ITCH/AIP4 Co-immunoprecipitation TRPV4 ITCH/AIP4 Co-immunofluorescence staining TRPV4 ITCH/AIP4 Co-immunofluorescence staining TRPV4 UBC In vivo PTM assay TRPV4 ITCH/AIP4 Inference TRPV4 UBC Inference TRPV4 UBC In vivo PTM assay TRPV4 OS-9 Yeast two-hybrid TRPV4 OS-9 Co-immunoprecipitation TRPV4 OS-9 Co-immunoprecipitation TRPV4 OS-9 Co-immunofluorescence staining TRPV4 OS-9 Cell surface biotinylation TRPV4 Pacsin3 Co-immunoprecipitation TRPV4 Pacsin2 Co-immunofluorescence staining TRPV4 Pacsin3 Co-immunofluorescence staining TRPV4 Pacsin3 Patch clamp TRPV4 LYN Co-immunoprecipitation TRPV4 α2-integrin Co-immunoprecipitation TRPV4 α2-integrin Inference TRPV4 IP3R3 Calcium measurement TRPV4 IP3R3 Patch clamp TRPV4 IP3R3 Co-immunoprecipitation TRPV4 IP3R3 Inference TRPV4 TRPP1 Co-immunoprecipitation TRPV4 TRPP1 Co-immunofluorescence staining TRPV4 TRPP1 Fluorescence resonance energy transfer TRPV4 TRPP1 Inference TRPV4 TRPP1 Patch clamp 148 Chapter 6. Appendix TRP channel Protein interactor Experiment TRPV4 AKAP5/AKAP150 Co-immunoprecipitation TRPV4 AKAP5/AKAP150 Speculation TRPV4 IP3R3 Co-immunoprecipitation TRPV4 IP3R3 Co-immunoprecipitation TRPV4 IP3R3 Calcium measurement TRPV4 IP3R3 Patch clamp TRPV4 α-actin Fluorescence resonance energy transfer TRPV4 α-actin Co-immunofluorescence staining TRPV4 α-actin Inference TRPV4 SRC In vivo PTM assay TRPV4 SRC In vivo PTM assay TRPV4 SRC Calcium measurement TRPV4 80K-H Co-immunoprecipitation TRPV4 80K-H Speculation TRPV4 Calmodulin Fusion protein-pull down assay TRPV4 α-arrestin 2 Affinity purification-mass spectrometry TRPV4 α-arrestin 1 Co-immunoprecipitation TRPV4 α-arrestin 1 Inference TRPV4 α-arrestin 1 Co-immunoprecipitation TRPV4 AT1aR Inference TRPV4 AT1aR Co-immunoprecipitation TRPV4 AT1aR Co-immunofluorescence staining TRPV4 AT1aR Co-immunoprecipitation TRPV4 ITCH/AIP4 Co-immunoprecipitation TRPV4 α-catenin Co-immunoprecipitation TRPV4 E-cadherin Co-immunoprecipitation TRPV4 α-catenin Yeast two-hybrid TRPV4 E-cadherin Inference TRPV4 α-catenin Co-immunoprecipitation TRPV4 α-catenin Co-immunoprecipitation TRPV4 Calmodulin Fusion protein-pull down assay TRPV4 Caveolin-1 Co-immunofluorescence staining 149 Chapter 6. Appendix TRP channel Protein interactor Experiment TRPV4 TRPC1 Inference TRPV4 Caveolin-1 Inference TRPV4 TRPC1 Co-immunofluorescence staining TRPV4 TRPC1 Fluorescence resonance energy transfer TRPV4 TRPC1 Co-immunoprecipitation TRPV4 TRPC1 Calcium measurement TRPV4 TRPC1 Co-immunoprecipitation TRPV4 TRPC1 Co-immunofluorescence staining TRPV4 TRPC1 Co-immunofluorescence staining TRPV4 TRPC1 Calcium measurement TRPV4 TRPC1 Cell surface biotinylation TRPV4 TRPC1 Fluorescence resonance energy transfer TRPV4 AQP-4 Inference TRPV4 AQP-4 Co-immunofluorescence staining TRPV4 AQP-4 Co-immunoprecipitation TRPV4 AQP-4 Co-immunoprecipitation TRPV4 TRPP1 Co-immunoprecipitation TRPV4 TRPP1 Atomic force microscopy(AFM) analysis TRPV4 TRPC1 Fluorescence resonance energy transfer TRPV4 TRPC1 Fluorescence resonance energy transfer TRPV4 Calmodulin Fusion protein-pull down assay TRPV4 α-actin Co-immunoprecipitation TRPV4 α-actin Fusion protein-pull down assay TRPV4 Tubulin Co-immunoprecipitation TRPV4 Tubulin Fusion protein-pull down assay TRPV4 α-actin Inference TRPV4 α-actin Fusion protein-pull down assay TRPV4 Tubulin Fusion protein-pull down assay TRPV4 α-tubulin-5 Inference TRPV4 α-tubulin-5 Co-immunoprecipitation TRPV4 α-tubulin-5 Co-immunofluorescence staining TRPV4 E-cadherin Co-immunoprecipitation 150 Chapter 6. Appendix TRP channel Protein interactor Experiment TRPV4 α-catenin Co-immunoprecipitation TRPV4 TRPP1 Co-immunoprecipitation TRPV4 TRPP1 Co-immunofluorescence staining TRPV4 TRPP1 Co-immunoprecipitation TRPV4 TRPP1 Co-immunofluorescence staining TRPV4 TRPP1 Calcium measurement TRPV4 RPS27A Affinity purification-mass spectrometry TRPV4 Myosin-HIIA Affinity purification-mass spectrometry TRPV4 Myosin-10 Affinity purification-mass spectrometry TRPV4 Calmodulin Fusion protein-pull down assay TRPV4 Myosin-HIIA Co-immunofluorescence staining TRPV4 Myosin-10 Co-immunofluorescence staining TRPV4 TRPP1 Co-immunofluorescence staining TRPV4 TRPP1 Co-immunoprecipitation TRPV4 TRPP1 Co-immunoprecipitation TRPV4 Pacsin3 Fluorescence resonance energy transfer TRPV4 TMEM16A/ANO1 Inference TRPV4 TMEM16A/ANO1 Co-immunoprecipitation TRPV4 AKAP5/AKAP150 Co-immunofluorescence staining TRPV4 AKAP5/AKAP150 Patch clamp TRPV4 TRPP1 Co-immunoprecipitation TRPV4 TRPC1 Co-immunoprecipitation TRPV4 TRPP1 Co-immunoprecipitation TRPV4 TRPC1 Co-immunoprecipitation TRPV4 TRPP1 Fluorescence resonance energy transfer TRPV4 TRPC1 Fluorescence resonance energy transfer TRPV4 TRPP1 Patch clamp TRPV4 TRPC1 Patch clamp TRPV4 Bkca Inference TRPV4 Bkca Co-immunoprecipitation TRPV4 TRPC1 Co-immunoprecipitation 151 Chapter 6. Appendix 6.2 Appendix - Purification of biotinylated TRPV4 N-terminal proteins 150 hsV4 ARD wt Avi hsV4 ARD R232C Avi hsV4 ARD K276E Avi M [kDa] Coomassie 100 50 37 25 50 wt 2C 6E 23 R 2 7 K Superdex 75 0 40 50 60 70 80 90 100 Volume [mL] Figure 6.2: Purification of unbiotinylated hsV4 ARD Avi constructs. A SEC purifications of unbiotinylated hsV4 ARD Avi constructs. For biotinylated constructs see figure 4.1. SEC runs were either performed with a HiLoad Superdex 75 pg preparative SEC column. Inlet shows Coomassie stained 15 % SDS-PAGE of collected and concentrated fractions after SEC. x-axis: eluted volume in mL, y-axis: absorbency at 280 nm, M = marker. 6.3 Appendix - A beginning to elucidate the versatile TRPV4 interatcome Following tables contain the mass spec data of all significant identified protein interactome members of respective TRPV4 N-terminal construct. With gene ontology and manual cura- tion, each protein was investigated upon a possible role in RNP and/or stress granules. These tables present the current data situation in April 2021 and do not claim any comprehensive- ness. 152 Abs [mAu] 280nm Chapter 6. Appendix 153 Table 6.3: List of cytoplasmic RNP granule and stress granule proteins found in the hsV4N wt Avi protein interactome determined via two independent UDMSE in this work. p-values (Benjamini-Hochberg corrected Student’s t-test) were determined of the quadruplicates of each of the two UDMSE measurements, log2 fold change (log2 FC) between biotinylated and non-biotinylated hsV4N Avi wt (control) of each UDMSE measurement. Bold numbers assign p- and log2 FC values to respective UDMSE measurement. Manual data curation was performed to determine association of detected proteins with cytosolic ribonucleoprotein (RNP) and/or stress granules (see also figure 4.4). Respective literature is appended (Lit.). UniProt ID -log10 (p-value) 1 log2 FC 1 -log10 (p-value) 2 log2 FC 2 RNP granules Stress granules Lit. TRPV4_HUMAN 6.69 5.59 8.81 4.95 no no ABCD3_HUMAN 2.49 16.10 8.15 11.86 no no ATD3B_HUMAN 6.31 19.30 1.38 11.81 no no COPA_HUMAN 4.36 15.38 1.32 15.73 no no COX5B_HUMAN 4.25 17.66 5.43 8.72 no no DDX3X_HUMAN 4.83 17.06 2.38 13.00 yes yes 107–109,120,127,200–203 DDX5_HUMAN 2.77 17.53 5.94 14.63 no yes 107,203,204 DHX9_HUMAN 1.49 15.05 7.22 14.77 yes yes 108,120 HNRH1_HUMAN 7.02 18.54 6.60 11.31 no yes 108,200,205 HNRPF_HUMAN 4.35 18.24 6.25 11.34 no yes 108,205 HNRPM_HUMAN 3.03 18.57 6.27 4.44 no no HNRPU_HUMAN 5.91 18.05 1.75 13.27 yes yes 108,200,206 IF2B1_HUMAN 2.84 15.38 9.89 12.93 yes yes 107,108,120,200 PABP1_HUMAN 4.21 16.89 5.45 14.21 yes yes 107–109,207–209 PACN3_HUMAN 5.85 15.59 4.10 11.90 no no PHB2_HUMAN 5.20 4.12 4.10 5.54 no no PLEC_HUMAN 2.60 18.36 4.23 14.25 no no PRKDC_HUMAN 1.34 18.58 5.88 16.38 no no Chapter 6. Appendix 154 UniProt ID -log10 (p-value) 1 log2 FC 1 -log10 (p-value) 2 log2 FC 2 RNP granules Stress granules Lit RBM14_HUMAN 3.53 17.89 2.74 12.17 no no RL13_HUMAN 2.69 18.92 5.41 14.44 no no RL17_HUMAN 1.56 18.81 5.58 13.53 no no RL24_HUMAN 1.96 18.14 3.18 12.19 no no RL28_HUMAN 6.63 17.41 1.97 13.40 yes no 210 RL35_HUMAN 2.41 16.58 3.39 11.41 no no RL36_HUMAN 1.44 15.75 7.46 11.89 no no ROA2_HUMAN 5.33 17.21 5.69 12.44 yes yes 107,108,126,200,206,211 RS2_HUMAN 2.57 2.05 4.31 4.89 no no RS27A_HUMAN 2.56 18.47 6.68 11.46 no no RS6_HUMAN 2.62 18.19 5.73 5.14 yes yes 113,210,212 RS7_HUMAN 1.81 15.64 5.36 11.97 no no RS8_HUMAN 2.61 18.47 2.53 4.66 no no RT17_HUMAN 6.47 14.91 2.24 10.84 no no SYNE1_HUMAN 1.74 18.41 7.64 4.40 yes no 210 VDAC2_HUMAN 7.64 19.32 3.04 10.64 no no YBOX1_HUMAN 4.72 17.37 8.27 13.50 yes yes 107,108,116,120,206,213 Chapter 6. Appendix 155 Table 6.4: List of cytoplasmic hRNP granule and stress granule proteins found in the hsV4N protein interactome in the presence of 2 mM Ca2+ determined via UDMSE in this work. p-values (Benjamini-Hochberg corrected Student’s t-test) were determined of the quadruplicates of each of the two UDMSE measurements, log2 fold change (log2 FC) between biotinylated and non-biotinylated hsV4N wt Avi (control) of each UDMSE measurement. Bold numbers assign p- and log2 FC values to respective UDMSE measurement. Manual data curation was performed to determine association of detected proteins with cytosolic ribonucleoprotein (RNP) and/or stress granules (see also figure 4.5) UniProt ID -log10 (p-value) 1 log2 FC 1 -log10 (p-value) 2 log2 FC 2 RNP granules Stress granules Lit. TRPV4_HUMAN 4.09 5.22 7.84 4.84 no no ABCD3_HUMAN 2.83 15.59 7.01 12.56 no no ADT2_HUMAN 4.12 2.23 5.92 14.68 no no ATD3A_HUMAN 2.92 3.57 4.01 14.81 no yes 107 DDX3X_HUMAN 4.12 16.08 4.74 12.83 no yes 107–109,120,127,200–203 DDX5_HUMAN 11.47 16.85 3.87 15.03 no yes 107,203,204 DHX9_HUMAN 6.87 14.80 5.64 15.59 yes yes 108,120 EPIPL_HUMAN 5.86 19.97 5.59 16.62 no no HNRH1_HUMAN 5.38 18.46 9.19 11.61 no yes 108,200 HNRPF_HUMAN 3.10 17.89 6.14 11.59 no yes 108 HNRPM_HUMAN 4.38 17.72 4.75 4.66 no no HNRPU_HUMAN 7.60 17.83 2.39 2.35 yes yes 108,200,206 IF2B1_HUMAN 7.88 14.88 2.50 12.83 yes yes 107,108,120,200 KHDR1_HUMAN 6.30 16.40 3.18 11.28 no yes 107,124 KPYM_HUMAN 1.92 2.38 2.32 1.65 no no NFM_HUMAN 10.16 5.63 1.89 3.25 no no NPM_HUMAN 3.49 17.29 3.24 2.55 no no PABP1_HUMAN 2.93 16.51 4.24 14.47 yes yes 107–109,207–209 PACN3_HUMAN 3.80 14.89 3.61 11.80 no no PHB_HUMAN 5.52 19.99 6.46 12.40 no no Chapter 6. Appendix 156 UniProt ID -log10 (p-value) 1 log2 FC 1 -log10 (p-value) 2 log2 FC 2 RNP granules Stress granules Lit PHB2_HUMAN 4.42 3.91 6.45 6.23 no no PLEC_HUMAN 4.01 17.17 3.89 14.02 no no PRKDC_HUMAN 2.43 18.18 4.82 17.27 no no RBM14_HUMAN 5.47 16.65 1.54 12.23 no no RBM8A_HUMAN 2.98 15.49 6.78 12.36 no no RL10_HUMAN 6.07 18.16 7.41 14.58 no no RL11_HUMAN 3.94 2.38 6.05 12.75 no yes 108 RL12_HUMAN 7.93 17.25 7.36 12.75 no no RL13A_HUMAN 4.63 2.11 6.83 12.87 no no RL15_HUMAN 4.99 17.13 3.12 13.58 no no RL17_HUMAN 7.40 17.62 6.28 12.85 no no RL18_HUMAN 3.86 17.85 4.01 13.18 no no RL18A_HUMAN 3.59 1.98 7.71 14.77 no no RL21_HUMAN 1.41 16.53 6.67 13.64 no no RL24_HUMAN 5.33 18.21 7.50 11.93 no no RL27_HUMAN 2.48 16.29 2.96 11.82 no no RL28_HUMAN 5.31 16.46 5.06 13.23 yes no 210 RL3_HUMAN 3.59 1.35 2.75 3.50 no no RL30_HUMAN 1.63 16.97 2.37 4.89 no no RL32_HUMAN 6.36 16.23 6.67 12.51 no no RL34_HUMAN 3.70 3.59 1.87 12.69 no no RL35_HUMAN 3.99 16.07 5.67 8.49 no no RL36_HUMAN 4.11 15.61 7.19 11.17 no no RL36A_HUMAN 2.19 1.22 5.42 12.08 no no RL37A_HUMAN 8.27 17.13 8.85 10.63 no no RL5_HUMAN 1.61 2.81 8.25 14.26 no no Chapter 6. Appendix 157 UniProt ID -log10 (p-value) 1 log2 FC 1 -log10 (p-value) 2 log2 FC 2 RNP granules Stress granules Lit RL6_HUMAN 3.60 3.18 6.88 14.93 yes no 210 RL7A_HUMAN 5.69 16.96 3.85 13.91 no no RLA0_HUMAN 4.79 16.54 6.53 12.11 yes no 206,214 ROA2_HUMAN 8.18 17.08 2.05 2.29 yes yes 107,108,126,200,206,211 RS11_HUMAN 4.41 19.00 5.67 10.46 no no RS27A_HUMAN 5.65 17.35 8.03 11.64 no no RS27L_HUMAN 4.80 15.97 2.52 3.21 no no RS4X_HUMAN 6.93 17.79 8.12 13.23 yes no 206 RS6_HUMAN 5.88 17.81 2.69 5.23 yes yes 113,210,212 RS8_HUMAN 9.09 18.15 4.79 4.53 no no RS9_HUMAN 2.51 17.21 4.21 12.63 no no RT17_HUMAN 1.72 14.63 3.27 11.15 no no SYNE1_HUMAN 2.91 18.11 2.85 3.09 yes no 210 TBA3E_HUMAN 4.46 19.93 8.46 14.18 no no TBA4A_HUMAN 4.55 17.05 2.41 3.24 no yes 107 TBB4B_HUMAN 5.07 20.09 3.35 4.00 no no VDAC2_HUMAN 5.26 17.83 6.93 11.54 no no VIME_HUMAN 6.02 3.60 3.37 5.48 no no YBOX1_HUMAN 12.38 17.03 1.50 12.50 yes yes 107,108,116,120,206,213 Chapter 6. Appendix 158 Table 6.5: List of cytoplasmic hRNP granule and stress granule proteins found in the hsV4 ARD wt protein interactome determined via UDMSE in this work. p-values (Benjamini-Hochberg corrected Student’s t-test) were determined of the quadruplicates of each of the two UDMSE measurements, log2 fold change (log E2 FC) between biotinylated and non-biotinylated hsV4 ARD wt Avi (control) of each UDMS measurement. Manual data curation was performed to determine association of detected proteins with cytosolic ribonucleoprotein (RNP) and/or stress granules (see also figure 4.6 A) UniProt ID -log10 (p-value) 1 log2 FC RNP granules Stress granules Lit. TRPV4_HUMAN 2,13 15,77 no no 1433E_HUMAN 8,32 13,01 no no 1433T_HUMAN 12,43 13,15 no no ACLY_HUMAN 3,74 1,30 no no AK1A1_HUMAN 17,63 11,13 no no BOLA2_HUMAN 7,94 12,21 no no CAH2_HUMAN 3,41 2,46 no no COPD_HUMAN 6,28 12,09 no no DDX3X_HUMAN 2,13 0,98 no yes 107–109,120,127,200–203 DNJA1_HUMAN 2,74 1,24 no yes 107 ENOG_HUMAN 6,00 2,03 no no ERF3A_HUMAN 3,28 11,60 no no GSTP1_HUMAN 2,38 2,36 no no H31T_HUMAN 1,33 1,24 no no HNRH2_HUMAN 10,58 12,40 no yes 107 HNRPC_HUMAN 2,03 1,35 no no IF2B2_HUMAN 10,69 12,87 yes yes 107–109,120,204,215 IF4A1_HUMAN 3,16 1,19 no yes 107,108,216 MDHC_HUMAN 4,61 1,20 no no NONO_HUMAN 3,62 1,28 yes yes 107,217 Chapter 6. Appendix 159 UniProt ID -log10 (p-value) 1 log2 FC Lit. NPM_HUMAN 1,93 1,14 no no PEBP1_HUMAN 9,26 11,37 no no POTEE_HUMAN 8,02 12,79 no no POTEJ_HUMAN 7,70 10,43 no no PRDX6_HUMAN 6,73 11,79 no yes 107 PUR6_HUMAN 2,17 1,54 no no PUR9_HUMAN 9,44 11,06 no no RL11_HUMAN 1,92 1,39 no no RL27A_HUMAN 1,37 1,03 no no RL4_HUMAN 1,77 1,22 no no RL5_HUMAN 1,45 1,48 no no ROA2_HUMAN 1,65 0,97 no yes 107,108,126,211 RS13_HUMAN 1,86 1,36 no no SRSF3_HUMAN 1,60 1,02 no yes 211 SRSF8_HUMAN 4,03 1,29 no no TBA4A_HUMAN 4,19 1,04 no yes 107,129,130 TBB4A_HUMAN 6,67 11,30 no no TCPD_HUMAN 5,09 1,61 no no TIAR_HUMAN 7,76 11,87 no yes 107–109,205,207,218–220 UBP2L_HUMAN 1,36 1,38 no yes 107–109,221 YTHD3_HUMAN 2,49 1,28 no yes 107–109,222 Chapter 6. Appendix 160 Table 6.6: List of cytoplasmic hRNP granule and stress granule proteins found in the hsV4 ARD wt protein interactome in the presence of 2 mM Ca2+ determined via UDMSE in this work. p-values (Benjamini-Hochberg corrected Student’s t-test) were determined of the quadruplicates of each of the two UDMSE measurements, log2 fold change (log2 FC) between biotinylated and non-biotinylated hsV4 ARD wt Avi (control) of each UDMSE measurement. Manual data curation was performed to determine association of detected proteins with cytosolic ribonucleoprotein (RNP) and/or stress granules (see also figure 4.6 B). UniProt ID -log10 (p-value) log2 FC RNP granules Stress granules Lit. TRPV4_HUMAN 7,59 15,46 no no 1433E_HUMAN 22,08 12,87 no no 1433G_HUMAN 4,82 2,04 no no 1433T_HUMAN 13,78 11,98 no no ACLY_HUMAN 2,68 1,82 no no AK1A1_HUMAN 6,24 11,36 no no ALDOA_HUMAN 2,14 1,39 no no BOLA2_HUMAN 6,14 13,05 no no CAH2_HUMAN 4,08 2,50 no no COF1_HUMAN 1,69 1,19 no no COF2_HUMAN 2,19 2,08 no no COPD_HUMAN 5,54 12,27 no no DDX1_HUMAN 1,38 0,96 no yes 107–109,116 DDX3X_HUMAN 2,36 1,09 no yes 107–109,120,127,200–203 DDX5_HUMAN 2,14 1,22 yes yes 203,204 DNJA1_HUMAN 2,74 1,24 no yes 107 DNJC7_HUMAN 2,82 1,45 no no DUT_HUMAN 3,92 1,75 no no ENOG_HUMAN 2,27 2,80 no no ENPL_HUMAN 2,04 1,02 no no Chapter 6. Appendix 161 UniProt ID -log10 (p-value) log2 FC RNP granule Stress granules Lit. ERF3A_HUMAN 8,27 11,95 no no FKB1A_HUMAN 2,36 2,19 no no G3BP1_HUMAN 3,06 1,93 no yes 107–109,123,126,135,204,205,211,223 G3BP2_HUMAN 1,52 1,22 no yes 223,224 GSTP1_HUMAN 2,90 2,32 no no H31T_HUMAN 1,64 0,97 no no HNRH2_HUMAN 5,55 12,90 no yes 107 HNRPF_HUMAN 1,63 1,13 no yes 108 HNRPM_HUMAN 1,54 1,08 no yes 108 HS90A_HUMAN 1,04 1,50 no no HSP76_HUMAN 3,27 1,28 no no IF2B_HUMAN 2,66 1,85 no yes 107 IF2B2_HUMAN 11,80 14,12 yes yes 107–109,120,204,215 IF4A1_HUMAN 1,74 3,65 no yes 107,108,205,216 IF4G2_HUMAN 1,86 0,96 no yes 107,109 IF5A2_HUMAN 1,54 1,14 no yes 225 KCD12_HUMAN 2,71 1,31 no no LC7L2_HUMAN 1,13 1,00 no no LDHA_HUMAN 2,77 1,60 no no LDHB_HUMAN 2,26 1,48 no no MDHC_HUMAN 3,07 1,89 no no NONO_HUMAN 2,67 1,76 yes yes 107,217 NPM_HUMAN 3,15 1,62 no no NUCL_HUMAN 1,73 1,15 no no PABP1_HUMAN 1,92 1,15 no yes 107–109,127,202,226 PABP4_HUMAN 1,30 1,01 no no Chapter 6. Appendix 162 UniProt ID -log10 (p-value) log2 FC RNP granule Stress granules Lit. PDIA3_HUMAN 1,67 1,75 no yes 108 PEBP1_HUMAN 10,73 11,94 no no POTEE_HUMAN 13,55 13,94 no no POTEJ_HUMAN 11,06 11,50 no no PRDX1_HUMAN 2,66 1,21 no yes 107,108 PRDX2_HUMAN 11,42 13,82 no no PRDX6_HUMAN 5,10 12,41 no yes 107 PTBP1_HUMAN 2,05 1,45 no no PUR6_HUMAN 3,35 2,40 no no PUR9_HUMAN 15,84 11,19 no no RAN_HUMAN 1,69 1,22 no no RBM39_HUMAN 0,91 0,83 no no RL11_HUMAN 4,04 1,58 no no RL12_HUMAN 2,51 1,19 no no RL13_HUMAN 2,62 1,12 no no RL15_HUMAN 2,66 1,24 no no RL18A_HUMAN 2,61 1,31 no no RL21_HUMAN 3,30 1,38 no no RL23A_HUMAN 3,20 1,24 no no RL27A_HUMAN 1,65 0,95 no no RL28_HUMAN 2,12 1,49 no no RL3_HUMAN 4,54 1,62 no no RL34_HUMAN 1,61 1,22 no no RL36L_HUMAN 4,02 2,06 no no RL37A_HUMAN 3,38 1,37 no no RL4_HUMAN 5,13 1,61 no no Chapter 6. Appendix 163 UniProt ID -log10 (p-value) log2 FC RNP granule Stress granules Lit. RL5_HUMAN 4,83 1,88 no no RL6_HUMAN 2,00 1,10 no no RL7A_HUMAN 2,42 1,29 no no RLA0L_HUMAN 3,55 1,54 no no ROA1_HUMAN 2,99 1,10 no yes 107,108,219 RS11_HUMAN 3,84 1,45 no no RS13_HUMAN 3,88 1,63 no no RS15A_HUMAN 7,06 2,12 no no RS20_HUMAN 1,67 1,24 no no RS21_HUMAN 1,98 1,02 no no RS23_HUMAN 1,48 1,38 no no RS28_HUMAN 1,54 1,10 no no RS30_HUMAN 3,49 1,19 no no RS5_HUMAN 4,20 1,35 no no RS6_HUMAN 1,24 0,91 no no SRSF3_HUMAN 1,84 0,87 no yes 211 SRSF8_HUMAN 4,38 1,70 no no TAGL2_HUMAN 2,92 1,25 no no TBB3_HUMAN 2,23 1,92 no yes 107 TBB4A_HUMAN 5,94 10,47 no no TBB6_HUMAN 1,73 1,49 no no TCPA_HUMAN 2,21 1,72 no no TCPB_HUMAN 2,17 1,37 no no TCPD_HUMAN 3,32 1,75 no no TCPG_HUMAN 3,53 1,82 no no TCPH_HUMAN 1,94 1,29 no no Chapter 6. Appendix 164 UniProt ID -log10 (p-value) log2 FC RNP granule Stress granules Lit. TCPZ_HUMAN 4,15 1,61 no no TEBP_HUMAN 4,49 1,80 no no TIAR_HUMAN 6,73 12,86 no yes 107–109,205,207,218–220 TPIS_HUMAN 2,68 1,71 no no U2AF2_HUMAN 5,17 13,73 no yes 107 UBP2L_HUMAN 5,60 1,71 no yes 107–109,205,221 Chapter 6. Appendix 165 Table 6.7: List of cytoplasmic hRNP granule and stress granule proteins found in the hsV4 ARD R232C protein interactome determined via UDMSE in this work. p-values (Benjamini-Hochberg corrected Student’s t-test) were determined of the quadruplicates of each of the two UDMSE measurements, log2 fold change (log2 FC) between biotinylated and non-biotinylated hsV4 ARD wt Avi (control) of each UDMSE measurement. Manual data curation was performed to determine association of detected proteins with cytosolic ribonucleoprotein (RNP) and/or stress granules (see also figure 4.6 C). UniProt ID -log10 (p-value) log2 FC RNP granules Stress granules Lit. TRPV4_HUMAN 11,53 17,45 no no 1433F_HUMAN 1,33 1,18 no no DDX3X_HUMAN 5,06 2,18 no yes 107–109,120,127,200–203 IF4A3_HUMAN 10,43 11,91 no yes 108 NONO_HUMAN 2,01 2,05 yes yes 107,217 POTEJ_HUMAN 1,42 5,94 no no RL11_HUMAN 3,27 1,38 no no RL3_HUMAN 1,74 1,49 no no RL35A_HUMAN 2,93 1,51 no no RLA0_HUMAN 1,37 1,01 no no RS15A_HUMAN 2,22 1,12 no no RS6_HUMAN 1,48 1,05 no no SFPQ_HUMAN 3,65 1,92 no yes 107,217 SRSF7_HUMAN 1,49 1,38 no yes 227 U2AF2_HUMAN 2,55 1,58 no yes 107 Chapter 6. Appendix 166 Table 6.8: List of cytoplasmic hRNP granule and stress granule proteins found in the hsV4 ARD R232C protein interactome in the presence of 2 mM Ca2+ determined via UDMSE in this work. p-values (Benjamini-Hochberg corrected Student’s t-test) were determined of the quadru- plicates of each of the two UDMSE measurements, log2 fold change (log2 FC) between biotinylated and non-biotinylated hsV4 ARD wt Avi (control) of each UDMSE measurement. Manual data curation was performed to determine association of detected proteins with cytosolic ribonucleoprotein (RNP) and/or stress granules (see also figure 4.6 C). UniProt ID -log10 (p-value) log2 FC RNP granules Stress granules Lit. TRPV4_HUMAN 4,89 18,44 no no 1433F_HUMAN 3,02 1,98 no no DDX17_HUMAN 3,17 1,73 no yes 204 DDX3X_HUMAN 6,12 2,94 no yes 107–109,120,127,200–203 IF2B_HUMAN 2,19 1,49 no yes 107 IF4A3_HUMAN 2,94 12,58 no yes 108 KCD12_HUMAN 1,63 1,47 no no NONO_HUMAN 4,48 2,45 yes yes 107,217 POTEE_HUMAN 3,80 4,40 no no POTEJ_HUMAN 4,74 6,57 no no RL11_HUMAN 3,36 2,19 no no RL12_HUMAN 2,41 1,56 no no RL13_HUMAN 1,34 1,64 no no RL15_HUMAN 4,91 1,99 no no RL18A_HUMAN 1,63 2,13 no no RL24_HUMAN 1,72 1,83 no no RL29_HUMAN 4,07 1,83 no no RL3_HUMAN 3,57 2,42 no no RL34_HUMAN 3,07 2,04 no no RL37A_HUMAN 5,22 2,03 no no Chapter 6. Appendix 167 UniProt ID -log10 (p-value) log2 FC RNP granule Stress granules Lit. RL4_HUMAN 2,02 2,38 no no RL5_HUMAN 2,31 2,34 no no RL6_HUMAN 1,64 1,91 RL7A_HUMAN 1,62 1,95 no no ROA1_HUMAN 2,89 1,90 no yes 107,108,219 ROA2_HUMAN 1,38 1,43 no yes 107,108,126,211 RS13_HUMAN 2,99 1,75 no no RS15A_HUMAN 4,13 1,79 no no RS2_HUMAN 1,31 1,34 no no RS20_HUMAN 2,06 1,56 no no RS26L_HUMAN 1,71 1,96 no no RS6_HUMAN 1,52 2,17 no no RUVB1_HUMAN 2,12 1,62 no no SFPQ_HUMAN 4,23 2,37 no yes 107,217 SRSF2_HUMAN 2,44 2,68 no no SRSF3_HUMAN 2,80 1,66 no yes 211 SRSF7_HUMAN 4,13 3,02 no yes 227 TCPG_HUMAN 1,81 1,48 no no Chapter 6. Appendix 168 Table 6.9: List of cytoplasmic hRNP granule and stress granule proteins found in the hsV4 ARD K276E protein interactome determined via UDMSE in this work. p-values (Benjamini-Hochberg corrected Student’s t-test) were determined of the quadruplicates of each of the two UDMSE measurements, log2 fold change (log2 FC) between biotinylated and non-biotinylated hsV4 ARD wt Avi (control) of each UDMSE measurement. Manual data curation was performed to determine association of detected proteins with cytosolic ribonucleoprotein (RNP) and/or stress granules (see also figure 4.6 C). UniProt ID -log10 (p-value) log2 FC RNP granules Stress granules Lit. TRPV4_HUMAN 3,53 7,08 no no 1433B_HUMAN 5,12 12,38 no no 1433G_HUMAN 1,41 1,66 no no ACTBL_HUMAN 7,69 12,25 no no ACTS_HUMAN 5,49 13,82 no no AK1A1_HUMAN 3,91 12,76 no no ANXA5_HUMAN 6,41 12,13 no no BOLA2_HUMAN 1,56 1,10 no no CAPR1_HUMAN 4,12 1,70 no no DDX1_HUMAN 1,73 0,98 no yes 107–109,116 DDX17_HUMAN 3,21 1,37 no yes 204 DDX3X_HUMAN 7,16 2,41 no yes 107–109,120,127,200–203 DDX5_HUMAN 2,55 1,09 yes yes 203,204 DNJA1_HUMAN 2,86 0,93 no yes 107 ENSA_HUMAN 3,33 13,13 no no FKB1A_HUMAN 1,74 1,41 no no G3BP1_HUMAN 1,62 1,31 no yes 107–109,123,126,135,204,205,211,223 G3BP2_HUMAN 3,10 2,41 no yes 223,224 GGYF2_HUMAN 2,53 1,26 no no HAP28_HUMAN 2,79 1,76 no no Chapter 6. Appendix 169 UniProt ID -log10 (p-value) log2 FC RNP granule Stress granules Lit. HNRPU_HUMAN 1,94 1,23 yes yes 108,200,206 HS71A_HUMAN 0,06 1,10 no no HS74L_HUMAN 3,66 11,83 no no HS904_HUMAN 6,04 12,64 no no HSP72_HUMAN 4,49 2,04 no no IF2B2_HUMAN 10,10 13,62 yes yes 107–109,120,204,215 IF4A2_HUMAN 7,57 15,63 no yes 228 IF4A3_HUMAN 3,23 3,69 no yes 108 JUPI2_HUMAN 1,86 0,68 no no KHDR1_HUMAN 5,59 2,13 no yes 107,124 KR111_HUMAN 4,76 14,13 no no LKHA4_HUMAN 5,22 1,72 no no MDHC_HUMAN 1,90 1,38 no no MDHM_HUMAN 9,21 12,11 no no METK2_HUMAN 2,32 1,03 no no MOES_HUMAN 1,35 1,16 no no NOLC1_HUMAN 3,00 0,90 no yes 108 NONO_HUMAN 5,42 1,97 yes yes 107,217 NUCL_HUMAN 1,36 1,58 no no NUDC_HUMAN 3,48 0,01 no yes 107 PAL4A_HUMAN 1,69 2,65 no no PAP1L_HUMAN 1,51 0,95 no no PEBP1_HUMAN 4,28 2,25 no no POTEF_HUMAN 1,79 1,63 no no PRDX4_HUMAN 2,55 1,23 no no PRDX6_HUMAN 4,31 12,78 no yes 107 Chapter 6. Appendix 170 UniProt ID -log10 (p-value) log2 FC RNP granule Stress granules Lit. PUR9_HUMAN 5,26 2,02 no no RBM14_HUMAN 1,28 0,92 no no RBM39_HUMAN 1,34 0,75 no no RBM4_HUMAN 2,29 1,07 no no RL10A_HUMAN 2,30 1,95 no no RL11_HUMAN 5,22 1,88 no no RL12_HUMAN 1,70 0,97 no no RL13_HUMAN 2,79 1,56 no no RL15_HUMAN 4,42 1,63 no no RL18_HUMAN 1,49 2,37 no no RL18A_HUMAN 2,60 1,81 no no RL19_HUMAN 3,16 1,82 no no RL24_HUMAN 3,06 1,74 no no RL27_HUMAN 1,58 1,94 no no RL28_HUMAN 3,24 2,15 no no RL29_HUMAN 2,91 1,14 no no RL3_HUMAN 4,03 2,08 no no RL34_HUMAN 3,00 1,72 no no RL35A_HUMAN 2,70 1,47 no no RL36_HUMAN 2,28 1,62 no no RL36A_HUMAN 3,13 1,81 no no RL36L_HUMAN 4,07 1,76 no no RL4_HUMAN 4,62 1,95 no no RL5_HUMAN 3,94 1,72 no no RL6_HUMAN 2,81 1,32 no no RL7_HUMAN 3,39 13,95 no no Chapter 6. Appendix 171 UniProt ID -log10 (p-value) log2 FC RNP granule Stress granules Lit. RL7A_HUMAN 3,26 1,45 no no RL8_HUMAN 1,37 1,20 no no RLA0L_HUMAN 2,37 1,92 no no RMXL1_HUMAN 7,10 12,71 no no ROA1_HUMAN 4,19 1,80 no yes 107,108,219 ROA2_HUMAN 2,09 1,44 no yes 107,108,219 RS11_HUMAN 2,05 1,51 no no RS12_HUMAN 7,86 1,93 no no RS13_HUMAN 3,94 1,48 no no RS15A_HUMAN 3,35 1,29 no no RS16_HUMAN 1,55 1,14 no no RS17_HUMAN 2,09 1,44 no no RS19_HUMAN 1,67 1,92 no no RS20_HUMAN 2,13 1,45 no no RS23_HUMAN 3,59 1,80 no no RS24_HUMAN 1,47 1,40 no no RS26L_HUMAN 2,26 1,43 no no RS3_HUMAN 2,99 1,40 no no RS30_HUMAN 3,81 1,70 no no RS3A_HUMAN 2,19 1,48 no no RS4X_HUMAN 1,39 0,84 no no RS5_HUMAN 2,83 1,43 no no RS6_HUMAN 2,50 2,01 no no RS7_HUMAN 2,99 1,47 no no RS8_HUMAN 2,25 1,47 no no RS9_HUMAN 2,56 1,32 no no Chapter 6. Appendix 172 UniProt ID -log10 (p-value) log2 FC RNP granule Stress granules Lit. RUVB2_HUMAN 1,54 1,90 no no SFPQ_HUMAN 3,76 1,61 no yes 107,217 SRP09_HUMAN 1,98 2,02 no no SRSF1_HUMAN 3,40 1,95 no no SRSF3_HUMAN 1,95 1,09 no yes 211 SRSF6_HUMAN 3,63 2,00 no no SRSF7_HUMAN 4,73 2,40 no yes 227 STAU1_HUMAN 1,58 0,93 no yes 207 STK26_HUMAN 2,82 0,44 no no SYNC_HUMAN 2,88 13,32 no no TBB2B_HUMAN 5,59 2,16 no no TBB6_HUMAN 1,82 1,11 no no TERA_HUMAN 2,78 2,18 no no TR150_HUMAN 3,15 2,90 no no U2AF1_HUMAN 5,87 1,76 no yes 107 U2AF2_HUMAN 8,24 3,79 no no Chapter 6. Appendix 173 Table 6.10: List of cytoplasmic hRNP granule and stress granule proteins found in the hsV4 ARD K276E protein interactome in the presence of 2 mM Ca2+ determined via UDMSE in this work. p-values (Benjamini-Hochberg corrected Student’s t-test) were determined of the quadru- plicates of each of the two UDMSE measurements, log2 fold change (log2 FC) between biotinylated and non-biotinylated hsV4 ARD wt Avi (control) of each UDMSE measurement. Manual data curation was performed to determine association of detected proteins with cytosolic ribonucleoprotein (RNP) and/or stress granules (see also figure 4.6 C). UniProt ID -log10 (p-value) log2 FC RNP granules Stress granules Lit. TRPV4_HUMAN 12,31 6,54 no no ACLY_HUMAN 2,08 0,85 no no AK1A1_HUMAN 9,88 12,05 no no CAH2_HUMAN 4,39 1,19 no no DDX17_HUMAN 4,46 1,40 no yes 204 DDX3X_HUMAN 8,77 2,58 no yes 107–109,120,127,200–203 DDX5_HUMAN 3,01 1,19 yes yes 203,204 DNJA1_HUMAN 2,41 0,90 no yes 107 ENOG_HUMAN 3,68 1,70 no no G3BP1_HUMAN 1,53 0,95 no yes 107–109,123,126,135,204,205,211,223 G3BP2_HUMAN 4,44 2,67 no yes 223,224 GSTP1_HUMAN 1,50 1,05 no no HNRPU_HUMAN 2,70 0,92 yes yes 108,200,206 IF2B2_HUMAN 9,62 13,81 yes yes 107–109,120,204,215 IF4A2_HUMAN 11,20 14,24 no yes 228 IF4A3_HUMAN 6,41 2,94 no yes 108 IF4B_HUMAN 1,63 0,94 no yes 107,108,205 KCRB_HUMAN 3,11 1,32 no no KHDR1_HUMAN 5,13 2,33 no yes 107,124 LARP1_HUMAN 1,57 0,94 no yes 107 Chapter 6. Appendix 174 UniProt ID -log10 (p-value) log2 FC RNP granules Stress granules Lit. LDHA_HUMAN 1,53 1,02 no no NPM_HUMAN 1,20 1,13 no no NUCL_HUMAN 2,76 1,09 no no PABP4_HUMAN 1,49 0,84 no yes 107–109 PAL4A_HUMAN 2,95 2,17 no no PAP1L_HUMAN 2,73 1,01 no no PGK1_HUMAN 2,99 1,06 no no POTEF_HUMAN 2,18 1,21 no no PRDX6_HUMAN 7,42 12,63 no yes 107 PUR9_HUMAN 2,78 1,30 no no RBM39_HUMAN 2,78 1,11 no no RBM4_HUMAN 1,46 0,94 no no RCC2_HUMAN 4,46 13,25 no no RL10A_HUMAN 2,79 1,43 no no RL11_HUMAN 5,27 1,89 no no RL13_HUMAN 4,57 1,46 no no RL15_HUMAN 4,64 1,47 no no RL18_HUMAN 4,07 1,64 no no RL18A_HUMAN 4,58 1,59 no no RL19_HUMAN 5,36 1,68 no no RL23A_HUMAN 1,02 0,75 no no RL27_HUMAN 5,24 1,67 no no RL28_HUMAN 5,55 2,00 no no RL3_HUMAN 6,66 2,00 no no RL35A_HUMAN 4,43 1,42 no no RL36_HUMAN 4,32 1,63 no no Chapter 6. Appendix 175 UniProt ID -log10 (p-value) log2 FC RNP granules Stress granules Lit. RL4_HUMAN 5,76 1,80 no no RL5_HUMAN 4,90 1,75 no no RL6_HUMAN 2,80 1,15 no no RL7_HUMAN 8,39 13,76 no no RLA0L_HUMAN 6,38 1,68 no no RMXL1_HUMAN 8,49 12,60 no no ROA1_HUMAN 5,32 1,57 no yes 107,108,219 ROA2_HUMAN 5,20 1,56 no yes 107,108,219 RS12_HUMAN 4,81 1,74 no no RS13_HUMAN 5,45 1,57 no no RS15A_HUMAN 5,70 1,66 no no RS16_HUMAN 2,59 1,08 no no RS19_HUMAN 2,57 1,17 no no RS23_HUMAN 5,48 1,91 no no RS24_HUMAN 3,12 1,64 no no RS25_HUMAN 2,79 1,68 no no RS26L_HUMAN 3,49 1,68 no no RS27_HUMAN 1,45 1,67 no no RS3A_HUMAN 2,98 1,23 no no RS4X_HUMAN 2,43 1,00 no no RS5_HUMAN 2,92 1,28 no no RS7_HUMAN 3,80 1,38 no no RS8_HUMAN 3,18 1,22 no no RS9_HUMAN 3,51 1,29 no no RUVB2_HUMAN 2,57 1,09 no no SFPQ_HUMAN 6,76 1,77 no yes 107,217 Chapter 6. Appendix 176 UniProt ID -log10 (p-value) log2 FC RNP granules Stress granules Lit. SRP09_HUMAN 2,09 1,48 no no SRSF1_HUMAN 3,07 1,37 no no SRSF2_HUMAN 2,79 1,23 no no SRSF3_HUMAN 2,75 1,11 no yes 211 SRSF6_HUMAN 5,30 2,11 no no STAU1_HUMAN 2,51 1,15 no no SYEP_HUMAN 1,99 0,89 no no SYNC_HUMAN 9,01 12,25 no no TCPG_HUMAN 2,40 0,94 no no TERA_HUMAN 2,83 1,42 no no THIO_HUMAN 1,91 0,90 no no TR150_HUMAN 4,04 2,86 no no TRFL_HUMAN 1,58 1,26 no no UBP2L_HUMAN 1,62 0,69 no yes 107–109,205,221 YBOX1_HUMAN 1,78 0,96 yes yes 107,108,116,120,206,213 Chapter 6. Appendix 6.4 Appendix - The interaction between the two protean proteins TRPV4 and DDX3X 1,2 BMRA BMRA + hsV4A ARD wt hsV4A ARD wt 1,0 0,8 0,6 0,4 0,2 0,0 0 200 400 600 800 time [sec] Figure 6.3: hsV4 ARD does not influence or inhibit the assay components lactate dehydrogenase and pyruvate kinase. As a control for the ATPase experiments shown in section 4.2, figures 4.9 and 4.13, the well-characterized B. subtilis ATPase BmrA was also supplemented with hsV4 ARD to rule out unspecific effects of hsV4 ARD on the lactate dehydrogenase and pyruvate kinase used in this assay. No decrease in BmrA ATPase activity was observed upon hsV4 ARD wt supplementation. Furthermore, hsV4 ARD alone did not show ATPase activity. BmrA was kindly provided by M. Sc. 177 Extinction [a.u.] Chapter 6. Appendix 6.5 Appendix - An in cellulo study of the interaction between human TRPV4 and PACSIN1-3 Sequence alignment between rat and human TRPV4 performed with ClustalW.2 sp|Q9HBA0|TRPV4_HUMAN MADSSEGPRAGPGEVAELPGDESGTPGGEAFPLSSLANLFEGEDGSLSPSPADASRPAGP 60 sp|Q9ERZ8|TRPV4_RAT MADPGDGPRAAPGDVAEPPGDESGTSGGEAFPLSSLANLFEGEEGSSSLSPVDASRPAGP 60 *** .:****.**:*** ******* *****************:** * **.******** sp|Q9HBA0|TRPV4_HUMAN GDGRPNLRMKFQGAFRKGVPNPIDLLESTLYESSVVPGPKKAPMDSLFDYGTYRHHSSDN 120 sp|Q9ERZ8|TRPV4_RAT GDGRPNLRMKFQGAFRKGVPNPIDLLESTLYESSVVPGPKKAPMDSLFDYGTYRHHPSDN 120 ******************************************************** *** sp|Q9HBA0|TRPV4_HUMAN KRWRKKIIEKQPQSPKAPAPQPPPILKVFNRPILFDIVSRGSTADLDGLLPFLLTHKKRL 180 sp|Q9ERZ8|TRPV4_RAT KRWRRKVVEKQPQSPKAPAPQPPPILKVFNRPILFDIVSRGSTADLDGLLSYLLTHKKRL 180 ****:*::****************************************** :******** sp|Q9HBA0|TRPV4_HUMAN TDEEFREPSTGKTCLPKALLNLSNGRNDTIPVLLDIAERTGNMREFINSPFRDIYYRGQT 240 sp|Q9ERZ8|TRPV4_RAT TDEEFREPSTGKTCLPKALLNLSNGRNDTIPVLLDIAERTGNMREFINSPFRDIYYRGQT 240 ************************************************************ sp|Q9HBA0|TRPV4_HUMAN ALHIAIERRCKHYVELLVAQGADVHAQARGRFFQPKDEGGYFYFGELPLSLAACTNQPHI 300 sp|Q9ERZ8|TRPV4_RAT ALHIAIERRCKHYVELLVAQGADVHAQARGRFFQPKDEGGYFYFGELPLSLAACTNQPHI 300 ************************************************************ sp|Q9HBA0|TRPV4_HUMAN VNYLTENPHKKADMRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLLLKCARLFPDS 360 sp|Q9ERZ8|TRPV4_RAT VNYLTENPHKKADMRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLLLKCSRLFPDS 360 *****************************************************:****** sp|Q9HBA0|TRPV4_HUMAN NLEAVLNNDGLSPLMMAAKTGKIGIFQHIIRREVTDEDTRHLSRKFKDWAYGPVYSSLYD 420 sp|Q9ERZ8|TRPV4_RAT NLETVLNNDGLSPLMMAAKTGKIGVFQHIIRREVTDEDTRHLSRKFKDWAYGPVYSSLYD 420 ***:********************:*********************************** sp|Q9HBA0|TRPV4_HUMAN LSSLDTCGEEASVLEILVYNSKIENRHEMLAVEPINELLRDKWRKFGAVSFYINVVSYLC 480 sp|Q9ERZ8|TRPV4_RAT LSSLDTCGEEVSVLEILVYNSKIENRHEMLAVEPINELLRDKWRKFGAVSFYINVVSYLC 480 **********.************************************************* sp|Q9HBA0|TRPV4_HUMAN AMVIFTLTAYYQPLEGTPPYPYRTTVDYLRLAGEVITLFTGVLFFFTNIKDLFMKKCPGV 540 sp|Q9ERZ8|TRPV4_RAT AMVIFTLTAYYQPLEGTPPYPYRTTVDYLRLAGEVITLLTGVLFFFTSIKDLFMKKCPGV 540 **************************************:********.************ sp|Q9HBA0|TRPV4_HUMAN NSLFIDGSFQLLYFIYSVLVIVSAALYLAGIEAYLAVMVFALVLGWMNALYFTRGLKLTG 600 sp|Q9ERZ8|TRPV4_RAT NSLFVDGSFQLLYFIYSVLVVVSAALYLAGIEAYLAVMVFALVLGWMNALYFTRGLKLTG 600 ****:***************:*************************************** sp|Q9HBA0|TRPV4_HUMAN TYSIMIQKILFKDLFRFLLVYLLFMIGYASALVSLLNPCANMKVCNEDQTNCTVPTYPSC 660 sp|Q9ERZ8|TRPV4_RAT TYSIMIQKILFKDLFRFLLVYLLFMIGYASALVTLLNPCTNMKVCNEDQSNCTVPSYPAC 660 178 Chapter 6. Appendix *********************************:*****:*********:*****:**:* sp|Q9HBA0|TRPV4_HUMAN RDSETFSTFLLDLFKLTIGMGDLEMLSSTKYPVVFIILLVTYIILTFVLLLNMLIALMGE 720 sp|Q9ERZ8|TRPV4_RAT RDSETFSAFLLDLFKLTIGMGDLEMLSSAKYPVVFILLLVTYIILTFVLLLNMLIALMGE 720 *******:********************:*******:*********************** sp|Q9HBA0|TRPV4_HUMAN TVGQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRV 780 sp|Q9ERZ8|TRPV4_RAT TVGQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRV 780 ************************************************************ sp|Q9HBA0|TRPV4_HUMAN DEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSNPDE 840 sp|Q9ERZ8|TRPV4_RAT DEVNWSHWNQNLGIINEDPGKSEIYQYYGFSHTMGRLRRDRWSSVVPRVVELNKNSGTDE 840 *********************.* *********:**********************. ** sp|Q9HBA0|TRPV4_HUMAN VVVPLDSMGNPRCDGHQQGYPRKWRTDDAPL 871 sp|Q9ERZ8|TRPV4_RAT VVVPLDNLGNPNCDGHQQGYAPKWRAEDAPL 871 ******.:***.******** ***::**** Percent Identity Matrix 1: sp|Q9HBA0|TRPV4_HUMAN 100.00 94.83 2: sp|Q9ERZ8|TRPV4_RAT 94.83 100.00 Sequence alignment between mouse and human PACSIN orthologues performed with ClustalW.2 sp|Q9BY11|PACN1_HUMAN MSSSYDEASLAPEETTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQL 60 sp|Q61644|PACN1_MOUSE MSGSYDEA---SEEITDSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQL 57 **.***** ** ****************************.************.*** sp|Q9BY11|PACN1_HUMAN TDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDA 120 sp|Q61644|PACN1_MOUSE TDWAKRWRQLIEKGPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDA 117 **************************:****************.**************** sp|Q9BY11|PACN1_HUMAN YHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTE 180 sp|Q61644|PACN1_MOUSE YHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEERLAMTREMNSKTE 177 ***********************************************:************ sp|Q9BY11|PACN1_HUMAN QSVTPEQQKKLQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEK 240 sp|Q61644|PACN1_MOUSE QSVTPEQQKKLVDKVDKCRQDVQKTQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEK 237 *********** ******:**************************.************** sp|Q9BY11|PACN1_HUMAN RLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWP 300 sp|Q61644|PACN1_MOUSE RLVFLKEVLLDIKRHLNLAENSSYMHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWP 297 ************************:*********************************** sp|Q9BY11|PACN1_HUMAN QFEEWNPDLPHTTTKKEKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEW 360 sp|Q61644|PACN1_MOUSE QFEEWNPDLPHTTAKKEKQPKKAEGATLSNATGAVESTSQAGDRGSVSSYDRGQTYATEW 357 *************:***********.:*:************************* ***** 179 Chapter 6. Appendix sp|Q9BY11|PACN1_HUMAN SDDESGNPFGGSETNGGANPFEDDSKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDE 420 sp|Q61644|PACN1_MOUSE SDDESGNPFGGNEANGGANPFEDDAKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDE 417 ***********.*:**********:*********************************** sp|Q9BY11|PACN1_HUMAN QGWCRGRLDSGQLGLYPANYVEAI 444 sp|Q61644|PACN1_MOUSE QGWCRGRLDSGQLGLYPANYVEAI 441 ************************ Percent Identity Matrix 1: sp|Q9BY11|PACN1_HUMAN 100.00 95.46 2: sp|Q61644|PACN1_MOUSE 95.46 100.00 sp|Q9UNF0|PACN2_HUMAN MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLT 60 sp|Q9WVE8|PACN2_MOUSE MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCGDLMNCLHERARIEKAYAQQLT 60 **************************************.********************* sp|Q9UNF0|PACN2_HUMAN EWARRWRQLVEKGPQYGTVEKAWMAFMSEAERVSELHLEVKASLMNDDFEKIKNWQKEAF 120 sp|Q9WVE8|PACN2_MOUSE EWARRWRQLVEKGPQYGTVEKAWIAVMSEAERVSELHLEVKASLMNEDFEKIKNWQKEAF 120 ***********************:*.********************:************* sp|Q9UNF0|PACN2_HUMAN HKQMMGGFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHAACKEEKLAISREANSKADP 180 sp|Q9WVE8|PACN2_MOUSE HKQMMGGFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHTACKEEKLAISREANSKADP 180 ****************************************:******************* sp|Q9UNF0|PACN2_HUMAN SLNPEQLKKLQDKIEKCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKR 240 sp|Q9WVE8|PACN2_MOUSE SLNPEQLKKLQDKIEKCKQDVLKTKDKYEKSLKELDQTTPQYMENMEQVFEQCQQFEEKR 240 *************************:*********** ********************** sp|Q9UNF0|PACN2_HUMAN LRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQ 300 sp|Q9WVE8|PACN2_MOUSE LRFFREVLLEVQKHLDLSNVASYKTIYRELEQSIKAADAVEDLRWFRANHGPGMAMNWPQ 300 *********************.**:**::*****:************************* sp|Q9UNF0|PACN2_HUMAN FEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPSKPSSTLNVPSNPAQSAQSQSS 360 sp|Q9WVE8|PACN2_MOUSE FEEWSADLNRTLSRREKKKAVDGVTLTGINQTGDQSGQNKPGSNLSVPSNPAQSTQLQSS 360 ********************.*************** .**.*.*.********:* *** sp|Q9UNF0|PACN2_HUMAN YNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFD 420 sp|Q9WVE8|PACN2_MOUSE YNPFEDEDDTGSSISEKEDIKAKNVSSYEKTQTYPTDWSDDESNNPFSSTDANGDSNPFD 420 ************::***:* ************:*************************** sp|Q9UNF0|PACN2_HUMAN DDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPAN 480 sp|Q9WVE8|PACN2_MOUSE EDTTSGTEVRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPAN 480 :*:********************************:**************.********* sp|Q9UNF0|PACN2_HUMAN YVEAIQ 486 sp|Q9WVE8|PACN2_MOUSE YVEAIQ 486 180 Chapter 6. Appendix ****** Percent Identity Matrix 1: sp|Q9UNF0|PACN2_HUMAN 100.00 93.83 2: sp|Q9WVE8|PACN2_MOUSE 93.83 100.00 sp|Q9UKS6|PACN3_HUMAN MAPEEDAGGEALGGSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQLADW 60 sp|Q99JB8|PACN3_MOUSE MAPEEDAGGEVLGGSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQLADW 60 **********.************************************************* sp|Q9UKS6|PACN3_HUMAN ARKWRGTVEKGPQYGTLEKAWHAFFTAAERLSALHLEVREKLQGQDSERVRAWQRGAFHR 120 sp|Q99JB8|PACN3_MOUSE ARKWRGAVEKGPQYGTLEKAWHAFFTAAERLSELHLEVREKLHGPDSERVRTWQRGAFHR 120 ******:************************* *********:* ******:******** sp|Q9UKS6|PACN3_HUMAN PVLGGFRESRAAEDGFRKAQKPWLKRLKEVEASKKSYHAARKDEKTAQTRESHAKADSAV 180 sp|Q99JB8|PACN3_MOUSE PVLGGFRESRAAEDGFRKAQKPWLKRLKEVEASKKSYHTARKDEKTAQTRESHAKADSSM 180 **************************************:*******************:: sp|Q9UKS6|PACN3_HUMAN SQEQLRKLQERVERCAKEAEKTKAQYEQTLAELHRYTPRYMEDMEQAFETCQAAERQRLL 240 sp|Q99JB8|PACN3_MOUSE SQEQLRKLQERVGRCTKEAEKMKTQYEQTLAELNRYTPRYMEDMEQAFESCQAAERQRLL 240 ************ **:***** *:*********:***************:********** sp|Q9UKS6|PACN3_HUMAN FFKDMLLTLHQHLDLSSSEKFHELHRDLHQGIEAASDEEDLRWWRSTHGPGMAMNWPQFE 300 sp|Q99JB8|PACN3_MOUSE FFKDVLLTLHQHLDLSSSDKFHELHRDLQQSIEAASDEEDLRWWRSTHGPGMAMNWPQFE 300 ****:*************:*********:*.***************************** sp|Q9UKS6|PACN3_HUMAN EWSLDTQRTISRKEKGGRSPDEVTLTSIVPTRDGTAPPPQSPGSPGTGQDEEWSDEESPR 360 sp|Q99JB8|PACN3_MOUSE EWSLDTQRAISRKEKGGRSPDEVTLTSIVPTRDGTAPPPQSPSSPGSGQDEDWSDEESPR 360 ********:*********************************.***:****:******** sp|Q9UKS6|PACN3_HUMAN KAATGVRVRALYDYAGQEADELSFRAGEELLKMSEEDEQGWCQGQLQSGRIGLYPANYVE 420 sp|Q99JB8|PACN3_MOUSE KVATGVRVRALYDYAGQEADELSFRAGEELLKMSEEDEQGWCQGQLQSGRIGLYPANYVE 420 *.********************************************************** sp|Q9UKS6|PACN3_HUMAN CVGA 424 sp|Q99JB8|PACN3_MOUSE CVGA 424 **** Percent Identity Matrix 1: sp|Q9UKS6|PACN3_HUMAN 100.00 94.34 2: sp|Q99JB8|PACN3_MOUSE 94.34 100.00 Multiple sequence alignment between F-BARs of human PACSIN1-3 performed with ClustalW.2 sp|Q9UKS6|PACN3_F-BAR_HUMAN ---MAPEEDAGGEALGGSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQL 57 sp|Q9BY11|PACN1_F-BAR_HUMAN MSSSYDEASLAPEETTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQL 60 181 Chapter 6. Appendix sp|Q9UNF0|PACN2_F-BAR_HUMAN MSVTYDD-SVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQL 59 : . . * .****.***:***:*::******.**:.*.:***:*****.*** sp|Q9UKS6|PACN3_F-BAR_HUMAN ADWARKWRGTVEKGPQYGTLEKAWHAFFTAAERLSALHLEVREKLQGQDSERVRAWQRGA 117 sp|Q9BY11|PACN1_F-BAR_HUMAN TDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDA 120 sp|Q9UNF0|PACN2_F-BAR_HUMAN TEWARRWRQLVEKGPQYGTVEKAWMAFMSEAERVSELHLEVKASLMNDDFEKIKNWQKEA 119 ::**::** :*******::*:** *::: *:::* ** **: .* .:* *::: **: * sp|Q9UKS6|PACN3_F-BAR_HUMAN FHRPVLGGFRESRAAEDGFRKAQKPWLKRLKEVEASKKSYHAARKDEKTAQTRESHAKAD 177 sp|Q9BY11|PACN1_F-BAR_HUMAN YHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTE 180 sp|Q9UNF0|PACN2_F-BAR_HUMAN FHKQMMGGFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHAACKEEKLAISREANSKAD 179 :*: ::***:*:: ************ *::**:**:**::* * *:** * :** ::*:: sp|Q9UKS6|PACN3_F-BAR_HUMAN SAVSQEQLRKLQERVERCAKEAEKTKAQYEQTLAELHRYTPRYMEDMEQAFETCQAAERQ 237 sp|Q9BY11|PACN1_F-BAR_HUMAN QSVTPEQQKKLQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEK 240 sp|Q9UNF0|PACN2_F-BAR_HUMAN PSLNPEQLKKLQDKIEKCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEK 239 ::. ** :***:::::* ::. **: :**: * :: : **:***:***.** ** *.: sp|Q9UKS6|PACN3_F-BAR_HUMAN RLLFFKDMLLTLHQHLDLSSSEKFHELHRDLHQGIEAASDEED 280 sp|Q9BY11|PACN1_F-BAR_HUMAN RLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQED 283 sp|Q9UNF0|PACN2_F-BAR_HUMAN RLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVED 282 ** *::::** :::**:*:. : ::::*.*.*..*. ** Percent Identity Matrix 1: sp|Q9UKS6|PACN3_HUMAN 100.00 50.71 56.27 2: sp|Q9BY11|PACN1_HUMAN 50.71 100.00 71.63 3: sp|Q9UNF0|PACN2_HUMAN 56.27 71.63 100.00 182 Chapter 6. Appendix 6.6 Appendix -The small GTPase RhoA interacts with the TRPV4 Ankyrin Repeat Domain 15 N d RhoA G155 [ppm] RhoA + hsV4 ARD G50 T163 G14 G144 I151 G17 G152 S88 S160 N123 G116 L22 N94 T60 F106 S85 S73 Q29 K135 C159 T175 T100 K162 D120 L72 E142 C16D87 N149 H105 E97 G166 K119 Q136 M134 E102 K104 L179 F171Y66 N94NH2 V33 E158D76 V11 V103 V79 K98 T77 S91 K27 E169 C107 L121 D28D90 T127 K164 R122 V38 Q180 R168 E137 A174 D146 Y74 R128 M173 K133 E143 H126 L131 I112 E93 D67 E64 A61 W99 Y156 L21 E130 R176 Y34 V167 C20 D65 D45 A177 M147 A148 D124 R129 K51 V170 R145D78 D13 Q52 I46 M1 V110A153 A132 D165 I4 L57 V139 R150 A15 K6 V48 A3 K7 F154 I95 D59 L92 D49 E172 Y42 L81 E40 A2 I10 V9V53 E47 V43 I113 E54 M82 V35 W58ind W58 I80 L55 V115 F30 R5 E125 A56 K140 L114 W99ind A44 L8 A161 1 10 8 6 H d [ppm] Figure 6.4: 2D 1H-15N-NMR spectrum of 15N-RhoA: Overlay of spectra of 1H-15N RhoA 2D HSCQs of 15N-RhoA on its own (grey) confirms presence of a well-folded protein in the GDP-bound state. In the presence of hsV4 ARD wt (blue), significant line broadening is observed indicative of the formation of a high molecular weight complex. RhoA backbone NMR assignments were transferred from previously published data.170 183 135 130 125 120 115 110 105 Chapter 6. Appendix 15 N d RhoA G155 [ppm] RhoA + hsV4 ARD R269C G50 T163 G14 G144 I151 G17 G152 S88 S160 N123 G116 L22 N94 T60 S73 F106S85 Q29 K135 C159 T175 T100 K162 D120 L72 E142 C16D87 N149 H105 E97 G166 K119 M134 F171 E102K104 Q136 L179Y66 N94NH2 V33 E158D76 V11 V103 V79 K98 T77 S91 K27 E169 D90 C107 L121 D28 T127 K164 R122 V38 Q180 R168 E137 A174 D146 Y74 R128 E143 M173 K133 H126 L131 I112 E93 D67 W99 E64 A61 Y156L21 E130 V167R176 Y34 C20 D65 D45 A177 M147 A148 D124 R129 K51 R145 D78 D13 V170Q52 I46 M1 V110A153 A132 D165 I4 L57 V139 R150 A15 K6 V48 F154 I95 A3 K7 D59 L92 D49 E172 Y42 L81 E40 A2 V9 V53 I10 E47 V43 I113 E54 M82 I80 V35W58ind W58 L55 V115 F30 R5 E125 A56 K140 L114 W99ind A44 L8 A161 1 10 8 6 H d [ppm] Figure 6.5: 2D 1H-15N-NMR spectrum of 15N-RhoA: Overlay of spectra of 1H-15N RhoA 2D HSCQs of 15N-RhoA on its own (grey) confirms presence of a well-folded protein in the GDP-bound state. Addition of hsV4 ARD R269C (red) shows only minor effects on the RhoA spectrum. RhoA backbone NMR assignments were transferred from previously published data.170 6.7 Appendix - Interaction of ITCH requires the full TRPV4 N-terminus in vitro Following table contains MS data of ubiquitinated hsV4N after an in vitro ubiquitination assay with ITCH (see section 4.5, figure 4.25). MS experiments were carried out by the Johns Hopkins Mass Spectrometry and Proteomics Facility. 184 135 130 125 120 115 110 105 Chapter 6. Appendix 185 Table 6.11: MS data of ubiquitinated hsV4N after in vitro ubiquitination assay with ITCH (see section 4.5, figure 4.25). Ubiquitinated sequences are indicated in blue row color. # PSMs = peptide spectrum matches, total number of identified peptide sequences. Annotated Sequence Modifications # Proteins # PSMs Positions in master proteins (R).MKFQGAFR.(K) 1xOxidation [M1] 1 5 Q9HBA0 (69-76) (R).LTDEEFR.(E) 1 36 Q9HBA0 (180-186) (K).RLTDEEFR.(E) 2 52 Q9HBA0 (179-186) (R).PAGPGDGRPNLR.(M) 2 182 Q9HBA0 (57-68) (R).EFINSPFRDIYYRGQTALHIAIER.(R) 2 4 Q9HBA0 (225-248) (K).IIEKQPQSPK.(A) 1 2 Q9HBA0 (127-136) (K).TGKIGIFQHIIRR.(E) 2 43 Q9HBA0 (380-392) (K).DEGGYFYFGELPLSLAACTNQ 1xMethylThiol (C18); 1xMethylthio (C18) 2 11 Q9HBA0 (277-310) PHIVNYLTENPHK.(K) (R).CKHYVELLVAQGADVHAQAR.(G) 1xMethylthio (C1) 1 39 Q9HBA0 (250-269) (R).GRFFQPK.(D) 2 13 Q9HBA0 (270-276) (K).QPQSPK.(A) 2 5 Q9HBA0 (131-136) (K).MYDLLLLK.(C) 1 19 Q9HBA0 (345-352) (K).FQGAFR.(K) 2 8 Q9HBA0 (71-76) (R).LFPDSNLEAVLNNDGLSPLMMAAK.(T) 2 26 Q9HBA0 (356-379) (K).GVPNPIDLLESTLYESSVVPGPKK.(A) 1 13 Q9HBA0 (78-101) (R).LFPDSNLEAVLNNDGLSPLMMAAK.(T) 1xDeamidated (N); 1xOxidation (M) 1 38 Q9HBA0 (356-379) (R).PILFDIVSR.(G) 2 32 Q9HBA0 (152-160) (R).ENTKFVTKMYDLLLLK.(C) 1xOxidation (M9) 1 1 Q9HBA0 (337-352) (R).FFQPK.(D) 2 2 Q9HBA0 (272-276) (K).IGIFQHIIRR.(E) 2 38 Q9HBA0 (383-392) (R).LFPDSNLEAVLNNDGLSPLMMAAK.(T) 1xDeamidated (N); 2xOxidation (M20; M21) 1 95 Q9HBA0 (356-379) Chapter 6. Appendix 186 Annotated Sequence Modifications # Proteins # PSMs Positions in master proteins (K).GVPNPIDLLESTLYESSVVPGPK.(K) 2 53 Q9HBA0 (78-100) (R).LFPDSNLEAVLNNDGLSPLMMAAK.(T) 2xOxidation (M20; M21) 1 276 Q9HBA0 (356-379) (K).QPQSPKAPAPQPPPILK.(V) 2 7 Q9HBA0 (131-147) (K).VFNRPILFDIVSR.(G) 2 206 Q9HBA0 (148-160) (K).ALLNLSNGR.(N) 1xDeamidated (N7) 1 79 Q9HBA0 (198-206) (R).NDTIPVLLDIAER.(T) 1xDeamidated (N1) 1 47 Q9HBA0 (207-219) (R).GNTVLHALVAIADNTR.(E) 1xDeamidated (N) 1 76 Q9HBA0 (321-336) (K).ALLNLSNGR.(N) 1 42 Q9HBA0 (198-206) (R).NDTIPVLLDIAER.(T) 1 50 Q9HBA0 (207-219) (R).GNTVLHALVAIADNTR.(E) 1 177 Q9HBA0 (321-336) (K).ALLNLSNGR.(N) 2xDeamidated (N4; N7) 1 18 Q9HBA0 (198-206) (K).KAPMDSLFDYGTYR.(H) 1 51 Q9HBA0 (101-114) (K).KAPMDSLFDYGTYR.(H) 1xOxidation (M4) 1 467 Q9HBA0 (101-114) (KR).GQTALHIAIER.(R) 3 153 Q9HBA0 (238-248) (K).APAPQPPPILKVFNRPILFDIVSR.(G) 2 1 Q9HBA0 (137-160) (K).HYVELLVAQGADVHAQAR.(G) 2 2595 Q9HBA0 (252-269) (K).IGIFQHIIR.(R) 1 115 Q9HBA0 (383-391) (R).EFINSPFR.(D) 2 62 Q9HBA0 (225-232) (R).TGNMREFINSPFR.(D) 1xOxidation (M4) 1 3 Q9HBA0 (220-232) (K).MYDLLLLK.(C) 1xOxidation (M1) 1 141 Q9HBA0 (345-352) (K).APMDSLFDYGTYR.(H) 1xOxidation (M3) 1 166 Q9HBA0 (102-114) (R).QDSRGNTVLHALVAIADNTRENTK.(F) 1 15 Q9HBA0 (317-340) (K).VFNRPILFDIVSR.(G) 1xDeamidated (N3) 1 20 Q9HBA0 (148-160) (R).LFPDSNLEAVLNNDGLSPLMMAAK.(T) 1xOxidation (M) 1 135 Q9HBA0 (356-379) Chapter 6. Appendix 187 Annotated Sequence Modifications # Proteins # PSMs Positions in master proteins (R).GSTADLDGLLPFLLTHKK.(R) 2 5 Q9HBA0 (161-178) (K).TGKIGIFQHIIR.(R) 1 13 Q9HBA0 (380-391) (KR).GQTALHIAIERR.(NC) 3 68 Q9HBA0 (238-249) (R).AGPGEVAELPGDESGTPGGEAF 2 25 Q9HBA0 (10-56) PLSSLANLFEGEDGSLSPSPADASR.(P) (R).EFINSPFRDIYYR.(G) 2 3 Q9HBA0 (225-237) (R).EFINSPFR.(D) 1xDeamidated (N4) 1 42 Q9HBA0 (225-232) (R).HHSSDNK.(R) 2 5 Q9HBA0 (115-121) (K).ALLNLSNGRNDTIPVLLDIAER.(T) 1xDeamidated (N) 1 46 Q9HBA0 (198-219) (K).APAPQPPPILK.(V) 1 128 Q9HBA0 (137-147) (K).APAPQPPPILK.(V) 1xDeamidated (Q5) 1 8 Q9HBA0 (137-147) (K).RLTDEEFREPSTGK.(T) 2 96 Q9HBA0 (179-192) (R).LTDEEFREPSTGK.(T) 2 82 Q9HBA0 (180-192) (R).QDSRGNTVLHALVAIADNTR.(E) 1 19 Q9HBA0 (317-336) (R).GNTVLHALVAIADNTRENTK.(F) 1 11 Q9HBA0 (321-340) (R).GSTADLDGLLPFLLTHK.(K) 1 96 Q9HBA0 (161-177) (R).GNTVLHALVAIADNTRENTKFVTK.(M) 1 13 Q9HBA0 (321-344) (R).LFPDSNLEAVLNNDGLSPLMMAAKTGK.(I) 2xOxidation (M20; M21) 1 6 Q9HBA0 (356-382) (R).RQDSRGNTVLHALVAIADNTR.(E) 1 1 Q9HBA0 (316-336) (M).ADSSEGPR.(A) 1 13 Q9HBA0 (2-9) (K).DEGGYFYFGELPLSLAACTNQPHI 1xMethylthio (C18) 1 4 Q9HBA0 (277-311) VNYLTENPHKK.(A) (K).GVPNPIDLLESTLYESSVVPGPKK.(A) 1xGG (K) 1 10 Q9HBA0 (78-101) (K).IIEKQPQSPK.(A) 1xGG (K4) 1 1 Q9HBA0 (127-136) Chapter 6. Appendix 188 Annotated Sequence Modifications # Proteins # PSMs Positions in master proteins (K).KAPMDSLFDYGTYR.(H) 1xOxidation (M4); 1xGG (K1) 1 6 Q9HBA0 (101-114) (R).AGPGEVAELPGDESGTPGGEA 2 1 Q9HBA0 (10-56) FPLSSLANLFEGEDGSLSPSPADASR.(P) (R).KGVPNPIDLLESTLYESSVVPGPK.(K) 1 69 Q9HBA0 (77-100) (K).QPQSPKAPAPQPPPILK.(V) 1xGlyGly (K6); 1xGG (K6) 2 2 Q9HBA0 (131-147) (R).KGVPNPIDLLESTLYESSVVPGPK.(K) 1xGG (K1) 1 9 Q9HBA0 (77-100) Chapter 6. Appendix R RR PR P + + D RD + + RDR + D GS T H 4N A A H 4 M C N C A H AR + CH sV sV sV 4 ST I T V4 IT V4 IT C 4 T h h h G [kDa] hs hs sV TC H I h I 250 150 S3 100 S4 S1 50 S5 S2 Pure proteins Protein mixtures Figure 6.6: Annotated BN PAGE samples submitted for MS measurements. See tables 6.12 and 6.12 for MS data. Tables 6.12 and 6.12 show MS data of BN PAGE complexes of ITCH and hsV4N (see section 4.5, figure 4.24 ). For sample annotation, see figure 6.6. MS experiments were carried out by the Johns Hopkins Mass Spectrometry and Proteomics Facility. Due to the omission of detergent in the BN PAGE procedure, protein mixtures lead to smearing and therefore also slight contaminations in bands which supposedly should only contain one protein.85 This is also reflected in the quantitative values shown in tables 6.12 and 6.12. 189 Chapter 6. Appendix 190 Table 6.12: MS data of BN PAGE complexes of ITCH and hsV4N (see section 4.5, figure 4.24 and figure 6.6 for sample annotation). Indicated are quantitative values normalized to total MS spectra. Accession Number Molecular Weight S1_NtermMono S1_NtermMono S2_ARD_mono S2_ARD_mono TRPV4_HUMAN 98 kDa 294,96 301,25 361,61 367,44 ITCH_HUMAN 103 kDa 0 0 0 0 K2C1_HUMAN 66 kDa 34,829 30,233 11,533 13,42 K1C10_HUMAN 59 kDa 25,033 21,595 10,855 10,224 K1C9_HUMAN 62 kDa 20,68 24,834 8,8197 5,1122 K22E_HUMAN 65 kDa 17,414 15,116 10,177 10,864 ALBU_HUMAN 69 kDa 0 0 0 0 K1C16_HUMAN 51 kDa 8,7072 8,6379 0 0 K1C14_HUMAN 52 kDa 5,442 5,3987 4,0706 0 K2C5_HUMAN 62 kDa 0 0 0 0 K2C6A_HUMAN (+1) 60 kDa 0 0 0 0 DSG1_HUMAN 114 kDa 0 0 0 0 K1C17_HUMAN 48 kDa 0 0 0 0 IGG1_HUMAN (+1) 49 kDa 0 0 0 0 DESP_HUMAN 332 kDa 0 0 0 0 Chapter 6. Appendix 191 Accession Number Molecular Weight S3_ITCH_complex2 S3_ITCH_complex2 S4_ITCH_alone S4_ITCH_alone S5_Nterm_alone S5_Nterm_alone TRPV4_HUMAN 98 kDa 164,67 170,2 179,41 189,14 367,54 369,73 ITCH_HUMAN 103 kDa 100,8 99,609 173,49 162,82 14,82 16,876 K2C1_HUMAN 66 kDa 31,549 32,157 15,233 18,092 11,856 7,6708 K1C10_HUMAN 59 kDa 31,549 35,294 14,387 14,802 4,9401 4,6025 K1C9_HUMAN 62 kDa 20,007 18,039 15,233 13,158 7,9041 5,1139 K22E_HUMAN 65 kDa 17,698 16,471 9,3091 6,5788 0 3,0683 ALBU_HUMAN 69 kDa 12,312 12,549 0 0 0 0 K1C16_HUMAN 51 kDa 6,9254 6,2746 0 2,467 0 0 K1C14_HUMAN 52 kDa 0 6,2746 0 0 0 0 K2C5_HUMAN 62 kDa 7,6949 7,8432 0 0 0 0 K2C6A_HUMAN (+1) 60 kDa 5,3865 0 0 0 0 0 DSG1_HUMAN 114 kDa 2,3085 0 0 0 0 0 K1C17_HUMAN 48 kDa 3,8475 0 0 0 0 0 IGG1_HUMAN (+1) 49 kDa 0 2,353 0 0 0 0 DESP_HUMAN 332 kDa 2,3085 0 0 0 0 0 Chapter 6. Appendix 6.8 Appendix - TRPV4 and the actin cytoskeleton - connecting scientific disciplines F-actin Merge DAPI Figure 6.7: Fluorescence microscopy images show no effect of GSK-101 or HC-067 on the cytoskeleton of unstransfected HEK293 cells. 192 HC-067 Temp. [37 °C] GSK-101 Chapter 6. Appendix GFP and TRITC GSK-101 HC-067 Temp. 0 0.2 0.4 0.6 0.8 1 r Figure 6.8: Pearson Correlation Coefficients (PCC, r) of respective TRITC and DAPI fluorescence marker pair. GFP showed TRPV4-cGFP localization, GSK-101 F-actin was counter-stained with Phalloidin-TRITC and the nucleus with DAPI. Higher PCC values HC-067 indicate stronger linear correlations of subjected images. See also 4.3. Box plot whiskers indicate values Temp. inside 1.5-fold interquartile range, green diamonds the arithmetic mean. Notches show 95 % confidence 0 0.2 0.4 0.6 0.8 1 r intervall of mode. Outliers are shown as circles. nGSK-101=18, nHC-067=28, GFP and DAPI nTemp=33. GSK-101 HC-067 Temp. 0 0.2 0.4 0.6 0.8 1 r 193 Chapter 6. Appendix TRITC and DAPI GSK-101 MTRITC GSK-101 MDAPI HC-067 MTRITC Figure 6.9: Calculated M-values of HC-067 MDAPI respective fluorescence marker Temp. MTRITC pairs as negative controls. GFP showed TRPV4-cGFP localization, Temp. MDAPI F-actin was counter-stained with 0 20 40 60 80 100 Phalloidin-TRITC and the nucleus % with DAPI. For description of M-values see equation 4.4 and GFP and DAPI corresponding text. Box plot whiskers GSK-101 MGFP indicate values inside 1.5-fold in- GSK-101 M terquartile range, green diamonds theDAPI arithmetic mean. Notches show 95 % HC-067 MGFP confidence intervall of mode. Outliers HC-067 M are shown as circles. nGSK-101=18,DAPI nHC-067=28, nTemp=33. Temp. MGFP Temp. MDAPI 0 20 40 60 80 100 % Table 6.14: P and M-values of GFP (TRPV4-cGFP) and TRITC (F-actin stained with Phalloidon TRITC) images of stably transfected HEK293 cells upon various treatments, determined and calculated by ELSEXY (see also figures 4.28, 6.9 and 6.8). PCC = Pearson correlation coeffi- cient r Image IDs PCC (r) P-Value [%] MGFP-Value MTRITC-Value GSK-101 treatment: Aufnahme-853-Aufnahme-854 0.5200 100.00 78.2787 86.0679 Aufnahme-857-Aufnahme-858 0.2732 100.00 62.2298 81.1937 Aufnahme-861-Aufnahme-862 0.4023 100.00 5.9401 4.2444 Aufnahme-867-Aufnahme-868 0.5681 100.00 9.9422 7.3226 Aufnahme-871-Aufnahme-873 0.7425 100.00 94.2158 97.9657 Aufnahme-876-Aufnahme-877 0.8212 100.00 93.5949 97.0998 Aufnahme-880-Aufnahme-881 0.6831 100.00 95.9003 97.4444 Aufnahme-884-Aufnahme-885 0.8237 100.00 92.8449 94.4432 Aufnahme-889-Aufnahme-890 0.5636 100.00 95.5037 99.8089 Aufnahme-893-Aufnahme-894 0.7147 100.00 94.6725 98.1046 Aufnahme-897-Aufnahme-898 0.7655 100.00 92.6020 96.5671 Aufnahme-901-Aufnahme-902 0.7937 100.00 93.3543 96.6338 Aufnahme-909-Aufnahme-910 0.2758 100.00 9.6166 3.1952 Aufnahme-913-Aufnahme-914 0.2837 100.00 7.1438 3.7441 194 Chapter 6. Appendix Image IDs PCC (r) P-Value [%] MGFP-Value MTRITC-Value Aufnahme-917-Aufnahme-918 0.2267 100.00 7.4609 2.3810 Aufnahme-921-Aufnahme-922 0.2634 100.00 69.0527 77.5663 Aufnahme-925-Aufnahme-926 0.2891 100.00 11.7675 3.1167 Aufnahme-930-Aufnahme-931 0.2809 100.00 9.1041 2.3597 Temperature treatment: Aufnahme-715-Aufnahme-717 0.2734 100.00 56.6989 81.8237 Aufnahme-722-Aufnahme-723 0.3650 100.00 57.1273 85.8436 Aufnahme-726-Aufnahme-727 0.3448 100.00 63.5204 82.0378 Aufnahme-730-Aufnahme-731 0.4119 100.00 74.7003 92.5601 Aufnahme-734-Aufnahme-735 0.5359 100.00 84.3648 98.6884 Aufnahme-738-Aufnahme-739 0.6848 100.00 90.3637 99.3332 Aufnahme-742-Aufnahme-743 0.1857 100.00 40.4781 50.9899 Aufnahme-746-Aufnahme-747 0.4916 100.00 66.8480 83.7768 Aufnahme-750-Aufnahme-751 0.1890 100.00 48.0745 54.6190 Aufnahme-754-Aufnahme-755 0.2810 100.00 47.5923 63.3100 Aufnahme-758-Aufnahme-759 0.3313 100.00 59.1588 75.0643 Aufnahme-763-Aufnahme-764 0.5716 100.00 80.0658 91.6231 Aufnahme-768-Aufnahme-769 0.3009 100.00 54.5052 76.3846 Aufnahme-772-Aufnahme-773 0.4322 100.00 66.4405 83.4705 Aufnahme-776-Aufnahme-777 0.2188 100.00 46.8050 44.2958 Aufnahme-780-Aufnahme-781 0.3458 100.00 50.2426 54.6213 Aufnahme-784-Aufnahme-785 0.4276 100.00 76.7970 78.3063 Aufnahme-788-Aufnahme-789 0.5264 100.00 87.7442 92.1042 Aufnahme-792-Aufnahme-793 0.5648 100.00 90.8593 95.6255 Aufnahme-796-Aufnahme-797 0.1653 100.00 43.9615 63.6713 Aufnahme-800-Aufnahme-801 0.1535 100.00 38.4351 57.4055 Aufnahme-804-Aufnahme-805 0.2361 100.00 44.8965 73.5039 Aufnahme-808-Aufnahme-809 0.3448 100.00 61.8572 81.7557 Aufnahme-812-Aufnahme-813 0.4092 100.00 78.1647 93.3742 Aufnahme-816-Aufnahme-817 0.4254 100.00 78.3585 74.6014 Aufnahme-820-Aufnahme-821 0.5456 100.00 88.8685 89.4498 Aufnahme-824-Aufnahme-825 0.2165 100.00 40.9267 69.2274 Aufnahme-828-Aufnahme-829 0.2849 100.00 59.3778 79.9833 Aufnahme-837-Aufnahme-838 0.2854 100.00 64.8022 75.1479 Aufnahme-841-Aufnahme-842 0.3744 100.00 75.0187 88.7091 Aufnahme-845-Aufnahme-846 0.3607 100.00 69.7550 85.6324 Aufnahme-849-Aufnahme-850 0.4218 100.00 66.0904 84.9898 HC-067 treatment: Aufnahme-1000-Aufnahme-1001 0.6449 100.00 92.2383 93.8185 Aufnahme-1004-Aufnahme-1005 0.6120 100.00 87.9697 89.9036 Aufnahme-1008-Aufnahme-1009 0.6150 100.00 88.5064 90.1036 Aufnahme-1012-Aufnahme-1013 0.5533 100.00 83.3883 85.0252 Aufnahme-1016-Aufnahme-1017 0.5419 100.00 81.3487 83.1448 Aufnahme-1020-Aufnahme-1021 0.5114 100.00 73.9040 77.9632 Aufnahme-1024-Aufnahme-1025 0.5629 100.00 78.7804 82.4833 Aufnahme-1028-Aufnahme-1029 0.6287 100.00 87.5814 90.4300 195 Chapter 6. Appendix Image IDs PCC (r) P-Value [%] MGFP-Value MTRITC-Value Aufnahme-1032-Aufnahme-1033 0.6687 100.00 92.2003 93.6834 Aufnahme-1036-Aufnahme-1037 0.6806 100.00 91.7884 92.6963 Aufnahme-1040-Aufnahme-1041 0.6476 100.00 92.9055 93.5310 Aufnahme-1045-Aufnahme-1046 0.6432 100.00 88.5934 89.5814 Aufnahme-1049-Aufnahme-1050 0.7043 100.00 90.0797 91.3065 Aufnahme-1053-Aufnahme-1054 0.6106 100.00 90.8049 92.5187 Aufnahme-1057-Aufnahme-1058 0.6569 100.00 90.5583 92.7421 Aufnahme-1061-Aufnahme-1062 0.6972 100.00 91.0875 92.3391 Aufnahme-1065-Aufnahme-1066 0.6118 100.00 88.4876 89.9069 Aufnahme-1069-Aufnahme-1070 0.6212 100.00 87.1519 89.3313 Aufnahme-938-Aufnahme-939 0.6324 100.00 10.5299 3.4553 Aufnahme-942-Aufnahme-943 0.6250 100.00 85.4327 87.9572 Aufnahme-946-Aufnahme-947 0.4504 100.00 6.3986 2.6539 Aufnahme-950-Aufnahme-951 0.4398 100.00 76.8892 81.2257 Aufnahme-954-Aufnahme-955 0.6594 100.00 91.6085 92.9828 Aufnahme-958-Aufnahme-959 0.7064 100.00 94.0716 95.2790 Aufnahme-962-Aufnahme-963 0.4668 100.00 72.5181 75.0115 Aufnahme-966-Aufnahme-967 0.5041 100.00 73.5635 76.5784 Aufnahme-972-Aufnahme-973 0.5297 100.00 81.9084 84.7888 Aufnahme-976-Aufnahme-977 0.4837 100.00 79.9120 82.8985 Table 6.15: P and M-values of TRITC (F-actin stained with Phalloidon TRITC) and DAPI (Nu- cleus) images of stably transfected HEK293 cells upon various treatments, determined and cal- culated by ELSEXY (see also figures 4.28, 6.9 and 6.8). PCC = Pearson correlation coefficient r Image IDs PCC (r) P-Value [%] MTRITC-Value MDAPI-Value GSK-101 treatment: Aufnahme-854-Aufnahme-855 0.0453 87.75 2.2698 1.9382 Aufnahme-858-Aufnahme-859 -0.0776 99.99 9.0303 4.6092 Aufnahme-862-Aufnahme-863 -0.0823 99.99 4.7414 1.0634 Aufnahme-868-Aufnahme-869 -0.0120 53.32 2.9750 1.7098 Aufnahme-873-Aufnahme-874 -0.1359 100.00 5.9047 1.5552 Aufnahme-877-Aufnahme-878 -0.0314 72.60 6.2035 1.4343 Aufnahme-881-Aufnahme-882 -0.0318 73.16 4.9780 1.1867 Aufnahme-885-Aufnahme-887 -0.0101 52.66 5.5307 1.1056 Aufnahme-890-Aufnahme-891 -0.0088 52.05 6.6444 1.4626 Aufnahme-894-Aufnahme-895 -0.0241 62.51 4.6918 0.9261 Aufnahme-898-Aufnahme-899 0.0112 53.11 5.7763 1.3593 Aufnahme-902-Aufnahme-903 0.0100 52.55 5.2710 1.1873 Aufnahme-910-Aufnahme-911 -0.0271 67.22 6.4353 2.6085 196 Chapter 6. Appendix Image IDs PCC (r) P-Value [%] MTRITC-Value MDAPI-Value Aufnahme-914-Aufnahme-915 -0.0308 70.34 4.9065 2.5552 Aufnahme-918-Aufnahme-919 0.0156 56.52 4.2131 1.5957 Aufnahme-922-Aufnahme-923 0.1897 100.00 3.3455 1.5303 Aufnahme-926-Aufnahme-927 0.0370 79.59 4.5315 1.7017 Aufnahme-931-Aufnahme-932 0.0225 62.21 2.7836 0.9981 Temperature treatment: Aufnahme-715-Aufnahme-720 -0.0279 69.65 3.6567 2.1010 Aufnahme-722-Aufnahme-724 0.0025 50.14 1.2990 0.5988 Aufnahme-726-Aufnahme-728 -0.0571 96.69 4.4134 2.3618 Aufnahme-730-Aufnahme-732 -0.0304 71.63 1.6476 0.8968 Aufnahme-734-Aufnahme-736 -0.1550 100.00 3.7128 2.6887 Aufnahme-738-Aufnahme-740 -0.0339 76.10 2.5587 1.5470 Aufnahme-742-Aufnahme-744 -0.1645 100.00 9.7233 3.3940 Aufnahme-746-Aufnahme-748 -0.1533 100.00 2.7878 1.5764 Aufnahme-750-Aufnahme-752 -0.0598 98.28 0.1225 0.0027 Aufnahme-754-Aufnahme-756 -0.0191 58.85 5.3142 2.1340 Aufnahme-758-Aufnahme-760 -0.0544 96.39 4.9039 2.5055 Aufnahme-763-Aufnahme-765 -0.0743 99.98 4.2717 2.2736 Aufnahme-768-Aufnahme-770 -0.0419 86.53 12.5606 14.5611 Aufnahme-772-Aufnahme-774 -0.1626 100.00 3.7872 3.3313 Aufnahme-776-Aufnahme-778 -0.1146 100.00 5.9939 2.2270 Aufnahme-780-Aufnahme-782 -0.0635 99.43 4.8804 3.6756 Aufnahme-784-Aufnahme-786 -0.0368 79.79 11.1294 3.5519 Aufnahme-788-Aufnahme-790 -0.1036 100.00 6.3836 3.2530 Aufnahme-792-Aufnahme-794 -0.1636 100.00 3.5069 2.2702 Aufnahme-796-Aufnahme-798 0.0103 52.55 24.3181 41.1005 Aufnahme-800-Aufnahme-802 0.1172 100.00 0.1573 0.0037 Aufnahme-804-Aufnahme-806 -0.0439 88.24 7.3157 11.4028 Aufnahme-808-Aufnahme-810 -0.0128 54.17 5.7927 2.2767 Aufnahme-812-Aufnahme-814 -0.0659 99.45 3.3155 1.0491 Aufnahme-816-Aufnahme-818 0.1985 100.00 0.4610 0.0281 Aufnahme-820-Aufnahme-822 -0.1803 100.00 5.3852 2.9802 Aufnahme-824-Aufnahme-826 -0.0228 61.88 5.1411 2.5597 Aufnahme-828-Aufnahme-830 0.1261 100.00 33.0759 53.0580 Aufnahme-837-Aufnahme-839 -0.0173 56.81 11.0905 3.3428 Aufnahme-841-Aufnahme-843 -0.0255 64.93 4.7149 1.9215 Aufnahme-845-Aufnahme-847 -0.0404 83.73 6.3069 2.0690 Aufnahme-849-Aufnahme-851 -0.0426 87.13 2.9024 1.4929 HC-067: Aufnahme-1001-Aufnahme-1002 -0.0259 67.38 1.9920 0.4166 Aufnahme-1005-Aufnahme-1006 -0.1626 100.00 2.1678 0.4999 Aufnahme-1009-Aufnahme-1010 -0.1890 100.00 1.5087 0.3787 Aufnahme-1013-Aufnahme-1014 -0.0232 64.10 3.6097 0.8075 Aufnahme-1017-Aufnahme-1018 -0.0244 67.30 2.5572 0.5483 Aufnahme-1021-Aufnahme-1022 -0.1046 100.00 8.3782 1.7364 Aufnahme-1025-Aufnahme-1026 -0.0623 99.29 7.2097 1.6761 197 Chapter 6. Appendix Image IDs PCC (r) P-Value [%] MTRITC-Value MDAPI-Value Aufnahme-1029-Aufnahme-1030 -0.0603 98.82 11.7791 2.7133 Aufnahme-1033-Aufnahme-1034 -0.0585 98.79 5.5796 1.3661 Aufnahme-1037-Aufnahme-1038 -0.0731 99.96 4.1914 0.8995 Aufnahme-1041-Aufnahme-1042 -0.0707 99.92 5.0806 1.1388 Aufnahme-1046-Aufnahme-1047 -0.0963 100.00 7.8957 1.5447 Aufnahme-1050-Aufnahme-1051 0.0217 62.47 5.5741 1.3416 Aufnahme-1054-Aufnahme-1055 -0.0581 97.64 3.9439 0.9346 Aufnahme-1058-Aufnahme-1059 -0.1628 100.00 3.5124 0.8515 Aufnahme-1062-Aufnahme-1063 -0.0444 89.74 2.3205 0.7769 Aufnahme-1066-Aufnahme-1067 -0.0325 74.71 2.2184 0.4525 Aufnahme-1070-Aufnahme-1071 -0.0152 56.12 1.1900 0.3502 Aufnahme-939-Aufnahme-940 -0.1093 100.00 1.3381 0.3299 Aufnahme-943-Aufnahme-944 -0.1054 100.00 0.8397 0.2275 Aufnahme-947-Aufnahme-948 -0.0382 83.89 1.6123 0.4816 Aufnahme-951-Aufnahme-952 -0.1044 100.00 0.9972 0.3373 Aufnahme-955-Aufnahme-956 -0.1044 100.00 2.4847 0.6036 Aufnahme-959-Aufnahme-960 -0.0634 99.80 1.7299 0.3815 Aufnahme-963-Aufnahme-964 -0.0429 87.90 2.5499 0.7984 Aufnahme-967-Aufnahme-968 -0.1261 100.00 1.6800 0.4122 Aufnahme-973-Aufnahme-974 -0.1074 100.00 1.2766 0.1771 Aufnahme-977-Aufnahme-978 -0.1154 100.00 0.9108 0.1482 Table 6.16: P and M-values of GFP (TRPV4-cGFP) and DAPI (Nucleus) images of stably trans- fected HEK293 cells upon various treatments, determined and calculated by ELSEXY (see also figures 4.28, 6.9 and 6.8). PCC = Pearson correlation coefficient r Image IDs PCC (r) P-Value [%] MGFP-Value MDAPI-Value GSK-101 treatment: Aufnahme-853-Aufnahme-855 -0.1403 100.00 0.0100 0.0041 Aufnahme-857-Aufnahme-859 -0.0333 76.46 0.5327 0.3642 Aufnahme-861-Aufnahme-863 -0.0847 100.00 3.2794 0.7690 Aufnahme-867-Aufnahme-869 0.0096 52.33 1.7832 0.9969 Aufnahme-871-Aufnahme-874 -0.0300 73.40 0.9859 0.4895 Aufnahme-876-Aufnahme-878 -0.0167 57.37 0.7300 0.3754 Aufnahme-880-Aufnahme-882 -0.0435 92.08 0.8073 0.3559 Aufnahme-884-Aufnahme-887 -0.0289 70.83 0.7969 0.3878 Aufnahme-889-Aufnahme-891 -0.0163 58.52 1.2954 0.7190 Aufnahme-893-Aufnahme-895 0.0280 72.08 42.9159 56.7900 Aufnahme-897-Aufnahme-899 0.0570 98.34 38.5048 52.4213 Aufnahme-901-Aufnahme-903 0.0855 100.00 49.5204 64.0538 Aufnahme-909-Aufnahme-911 0.0146 55.46 9.8164 2.9068 Aufnahme-913-Aufnahme-915 0.0367 77.81 2.8104 1.4889 198 Chapter 6. Appendix Image IDs PCC (r) P-Value [%] MGFP-Value MDAPI-Value Aufnahme-917-Aufnahme-919 0.0218 61.57 9.1948 2.5784 Aufnahme-921-Aufnahme-923 -0.3342 100.00 0.8344 0.2907 Aufnahme-925-Aufnahme-927 0.0168 57.13 6.9142 1.1782 Aufnahme-930-Aufnahme-932 -0.0003 50.00 2.2941 0.2445 Temperature treatment: Aufnahme-715-Aufnahme-720 -0.0279 69.65 3.6567 2.1010 Aufnahme-722-Aufnahme-724 0.0025 50.14 1.2990 0.5988 Aufnahme-726-Aufnahme-728 -0.0571 96.69 4.4134 2.3618 Aufnahme-730-Aufnahme-732 -0.0304 71.63 1.6476 0.8968 Aufnahme-734-Aufnahme-736 -0.1550 100.00 3.7128 2.6887 Aufnahme-738-Aufnahme-740 -0.0339 76.10 2.5587 1.5470 Aufnahme-742-Aufnahme-744 -0.1645 100.00 9.7233 3.3940 Aufnahme-746-Aufnahme-748 -0.1533 100.00 2.7878 1.5764 Aufnahme-750-Aufnahme-752 -0.0598 98.28 0.1225 0.0027 Aufnahme-754-Aufnahme-756 -0.0191 58.85 5.3142 2.1340 Aufnahme-758-Aufnahme-760 -0.0544 96.39 4.9039 2.5055 Aufnahme-763-Aufnahme-765 -0.0743 99.98 4.2717 2.2736 Aufnahme-768-Aufnahme-770 -0.0419 86.53 12.5606 14.5611 Aufnahme-772-Aufnahme-774 -0.1626 100.00 3.7872 3.3313 Aufnahme-776-Aufnahme-778 -0.1146 100.00 5.9939 2.2270 Aufnahme-780-Aufnahme-782 -0.0635 99.43 4.8804 3.6756 Aufnahme-784-Aufnahme-786 -0.0368 79.79 11.1294 3.5519 Aufnahme-788-Aufnahme-790 -0.1036 100.00 6.3836 3.2530 Aufnahme-792-Aufnahme-794 -0.1636 100.00 3.5069 2.2702 Aufnahme-796-Aufnahme-798 0.0103 52.55 24.3181 41.1005 Aufnahme-800-Aufnahme-802 0.1172 100.00 0.1573 0.0037 Aufnahme-804-Aufnahme-806 -0.0439 88.24 7.3157 11.4028 Aufnahme-808-Aufnahme-810 -0.0128 54.17 5.7927 2.2767 Aufnahme-812-Aufnahme-814 -0.0659 99.45 3.3155 1.0491 Aufnahme-816-Aufnahme-818 0.1985 100.00 0.4610 0.0281 Aufnahme-820-Aufnahme-822 -0.1803 100.00 5.3852 2.9802 Aufnahme-824-Aufnahme-826 -0.0228 61.88 5.1411 2.5597 Aufnahme-828-Aufnahme-830 0.1261 100.00 33.0759 53.0580 Aufnahme-837-Aufnahme-839 -0.0173 56.81 11.0905 3.3428 Aufnahme-841-Aufnahme-843 -0.0255 64.93 4.7149 1.9215 Aufnahme-845-Aufnahme-847 -0.0404 83.73 6.3069 2.0690 Aufnahme-849-Aufnahme-851 -0.0426 87.13 2.9024 1.4929 HC-067: Aufnahme-1000-Aufnahme-1002 -0.0451 90.68 3.1690 0.5565 Aufnahme-1004-Aufnahme-1006 -0.1631 100.00 4.8925 0.8189 Aufnahme-1008-Aufnahme-1010 -0.0314 75.59 3.7647 0.5352 Aufnahme-1012-Aufnahme-1014 0.0087 52.10 8.4618 1.4623 Aufnahme-1016-Aufnahme-1018 -0.0271 68.35 6.1828 1.0086 Aufnahme-1020-Aufnahme-1022 -0.0165 56.18 13.2830 2.1062 Aufnahme-1024-Aufnahme-1026 -0.0916 100.00 10.9515 1.8920 Aufnahme-1028-Aufnahme-1030 -0.0441 87.52 13.6688 3.2934 199 Chapter 6. Appendix Image IDs PCC (r) P-Value [%] MGFP-Value MDAPI-Value Aufnahme-1032-Aufnahme-1034 -0.0549 96.16 7.6856 1.7986 Aufnahme-1036-Aufnahme-1038 -0.0653 99.69 7.7639 1.8226 Aufnahme-1040-Aufnahme-1042 -0.0682 99.91 8.9296 2.1581 Aufnahme-1045-Aufnahme-1047 -0.0622 99.19 10.9042 2.4098 Aufnahme-1049-Aufnahme-1051 -0.0494 93.04 7.4204 1.5090 Aufnahme-1053-Aufnahme-1055 -0.0588 98.72 6.3371 1.6009 Aufnahme-1057-Aufnahme-1059 -0.0606 99.16 4.6242 1.3025 Aufnahme-1061-Aufnahme-1063 -0.0501 95.10 4.3516 1.0979 Aufnahme-1065-Aufnahme-1067 -0.1420 100.00 7.4282 1.2888 Aufnahme-1069-Aufnahme-1071 -0.0398 84.78 3.8079 0.7245 Aufnahme-938-Aufnahme-940 -0.1324 100.00 5.5320 0.8956 Aufnahme-942-Aufnahme-944 -0.0697 99.95 2.5526 0.5187 Aufnahme-946-Aufnahme-948 -0.0264 67.77 4.6858 0.9460 Aufnahme-950-Aufnahme-952 -0.0230 63.73 2.5941 0.6412 Aufnahme-954-Aufnahme-956 -0.0467 94.75 6.3291 1.3117 Aufnahme-958-Aufnahme-960 -0.0520 96.46 4.0165 0.8191 Aufnahme-962-Aufnahme-964 -0.0228 62.86 7.9805 1.6780 Aufnahme-966-Aufnahme-968 -0.0048 50.52 5.0571 1.1735 Aufnahme-972-Aufnahme-974 0.1943 100.00 3.7948 1.2591 Aufnahme-976-Aufnahme-978 0.0681 99.70 2.8181 0.9724 200 Chapter 6. Appendix 6.9 Appendix - Establishing HEK293 cell lines stably expressing TRP channels In the course of this work, HEK293 cells stably expressing human TRPV4-cGFP and TRPML1-cGFP, respectively, were estab- lished (see section 3.2.3 for procedure). In both cases, fluorescence microscopy images showed expected subcellular localization, as shown for human TRPV4-cGFP in figure 6.10 and human TRPML1-cGFP 6.12. Furthermore, for HEK293 hsTRPV4-cGFP cells, functionality of hsTRPV4-cGFP was confirmed via a Ca2+-influx assay, in agreement with McCray et al.69 hsTRPV4-cGFP DAPI Merge Figure 6.10: Fluorescence microscopy images of HEK293 cells stably transfected with hsTRPV4-cGFP. Stable transfection was achieved as described in subsection 3.2.3. hsTRPV4-cGFP shows expected plasma membrane localization. Figure 6.11: Stably transfected HEK293 cells express funtional hsTRPV4-cGFP. Functionality of expressed hsTRPV4-cGFP upon GSK101 activation, evaluated via a Ca2+-influx assay performed with the Fluo-4 Direct Calcium Assay (see table 2.18). x-axis = time in seconds, y-axis: fluorescence in arbitrary units. Averages represent n = 3, error bars indicate SD. 201 fluorescence [au] Chapter 6. Appendix hsTRPML-1 cGFP DAPI Merge Figure 6.12: Fluorescence microscopy images of HEK293 cells stabily transfected with hsTRPML1-cGFP. Stable trans- fection was achieved as described in subsection 3.2.3. hsTRPML1-cGFP shows expected localization in vesicular structures (indicated by white arrow heads), which are most likely lysosomes.229 6.10 Appendix - Purification of ITCH WW domains ITCH contains four WW domains (WW1-4), which could be possible interaction domains for the TRPV4 PRR.230 To probe possible PPIs between the ITCH WW domains and TRPV4 PRR in detail recombinant expression of all four single WW domains and the tandem domains WW1+2 and 3+4 was established (see section 3.7.8). Furthermore, first purifications and characterizations of the WW1+2 and 2+3 tandem domains were carried out (figure 6.13). A B 5 ITCH WW1+2 tandem domain 1400 ITCH WW1+2 tandem domain ITCH WW3+4 tandem domain ITCH WW3+4 tandem domain 1200 MW MW Coomassie [kDa] Coomassie [kDa] 0 1000 1 .0 random coil 50 50 b-sheet 37 0 .9 a-helix 37 0 .8 800 25 25 20 0 .7 20 -5 15 0 .6 600 15 0 .5 10 10 0 .4 400 0 .3 ITCH ITCH -10 WW1+2 WW3+4 0 .2 0 .1 200 Superdex75 0 .0 CH H IT 2 1+ IT C 3+ 4 W W W W 0 -15 40 50 60 70 80 90 100 110 120 190 200 210 220 230 240 250 Volume [mL] l [nm] Figure 6.13: Purification of recombinant human ITCH WW domains A SEC purification of human ITCH WW1+2 and WW3+4 tandem domains. SEC runs were performed with a HiLoad Superdex 75 pg preparative SEC column. Inlet shows Coomassie stained 15 % SDS-PAGE of collected and concentrated fractions after SEC. x-axis: eluted volume in mL, y-axis: absorbency at 280 nm, M = marker. B Far UV CD spectrum of human WW1+2 and WW3+4 tandem domains. Spectra were measured at 293 K and proteins were used at 1µM concentration in either SEC Buffer with a final NaCl concentration of 20 mM NaCl. Inlet shows secondary structure prediction performed with CAPITO.93 The predicted α-helix/β-sheet/random coil content of the purified proteins is for ITCH WW1+2 tandem domain 10 %/32 %/58 % and ITCH WW3+4 tandem domain 5 %/37 %/59 %. x-axis: mean residue ellipticity ([Θ] −3mrw,λ) in 10 deg cm2 dmol−1, y-axis: wavelength λ in nm. 202 Abs [mAu] 280nm 3 2 -1 q [10 deg cm dmol ] mrw, l sec. structure content Chapter 6. Appendix 6.11 Appendix - Purification of YAP1 WW domains YAP1 contains two WW domains, which could be possible interaction domains for the TRPV4 PRR.230 To probe possible PPIs between the YAP1 WW domains and TRPV4 PRR in detail, recombinant expression of the YAP-1 WW1 domain and YAP1 WW1+2 tandem domain was established (see section 3.7.9). Furthermore, first purifications and characterizations of the YAP1 WW1 and WW1+2 tandem domain were carried out (figure 6.14). Expression conditions and subsequent purification of the YAP1 WW2 domain have still to be optimized. A B 1200 MW 5 [kDa] hsYAP1 WW1+2 Coomassie hsYAP1 WW1+2 hsYAP-1 WW1 50 hsYAP1 WW1 hsYAP-1 WW2 37 1000 25 20 0 15 800 1 .0 random coil 10 b-sheet 0 .9 a-helix YAP-1 YAP-1 YAP-1 WW1 WW2 WW1+2 0 .8 600 -5 0 .7 0 .6 0 .5 0 .4 400 0 .3 -10 0 .2 0 .1 200 Superdex75 0 .0 1 1 YA P +2 P 1 YA 2 W W W W 0 -15 50 60 70 80 90 100 110 120 200 210 220 230 240 250 Volume [mL] l [nm] Figure 6.14: Purification of recombinant human YAP1 WW domains A SEC purification of human YAP1 WW1+2 tandem and YAP1 WW1 domain. SEC runs were performed with a HiLoad Superdex 75 pg preparative SEC column. Inlet shows Coomassie stained 15 % SDS-PAGE of collected and concentrated fractions after SEC. x-axis: eluted volume in mL, y-axis: absorbency at 280 nm, M = marker. B Far UV CD spectrum of human YAP1 WW1+2 tandem and YAP1 WW1 domain. Spectra were measured at 293 K and proteins were used at 1µM concentration in either SEC Buffer with a final NaCl concentration of 20 mM NaCl. Inlet shows secondary structure prediction performed with CAPITO.93 The predicted α-helix/β-sheet/random coil content of the purified proteins is for YAP WW1+2 tandem domain 3 %/50 %/47 % and YAP1 WW1 domain 2 %/42 %/56 %. x-axis: mean residue ellipticity ([Θ]mrw,λ) in 10−3 deg cm2 dmol−1, y-axis: wavelength λ in nm. 203 Abs [mAu] 280nm 3 2 -1 q [10 deg cm dmol ] mrw, l sec. structure content Chapter 6. Appendix 6.12 Appendix - Amino acid and DNA sequences hsV4N atggcggattccagcgaaggcccccgcgcggggcccggggaggtggctgagctccccggggatgagagtggcaccccaggtggggaggcttttcctctc M A D S S E G P R A G P G E V A E L P G D E S G T P G G E A F P L tcctccctggccaatctgtttgagggggaggatggctccctttcgccctcaccggctgatgccagtcgccctgctggcccaggcgatgggcgaccaaat S S L A N L F E G E D G S L S P S P A D A S R P A G P G D G R P N ctgcgcatgaagttccagggcgccttccgcaagggggtgcccaaccccatcgatctgctggagtccaccctatatgagtcctcggtggtgcctgggccc L R M K F Q G A F R K G V P N P I D L L E S T L Y E S S V V P G P aagaaagcacccatggactcactgtttgactacggcacctatcgtcaccactccagtgacaacaagaggtggaggaagaagatcatagagaagcagccg K K A P M D S L F D Y G T Y R H H S S D N K R W R K K I I E K Q P cagagccccaaagcccctgcccctcagccgccccccatcctcaaagtcttcaaccggcctatcctctttgacatcgtgtcccggggctccactgctgac Q S P K A P A P Q P P P I L K V F N R P I L F D I V S R G S T A D ctggacgggctgctcccattcttgctgacccacaagaaacgcctaactgatgaggagtttcgagagccatctacggggaagacctgcctgcccaaggcc L D G L L P F L L T H K K R L T D E E F R E P S T G K T C L P K A ttgctgaacctgagcaatggccgcaacgacaccatccctgtgctgctggacatcgcggagcgcaccggcaacatgagggagttcattaactcgcccttc L L N L S N G R N D T I P V L L D I A E R T G N M R E F I N S P F cgtgacatctactatcgaggtcagacagccctgcacatcgccattgagcgtcgctgcaaacactacgtggaacttctcgtggcccagggagctgatgtc R D I Y Y R G Q T A L H I A I E R R C K H Y V E L L V A Q G A D V cacgcccaggcccgtgggcgcttcttccagcccaaggatgaggggggctacttctactttggggagctgcccctgtcgctggctgcctgcaccaaccag H A Q A R G R F F Q P K D E G G Y F Y F G E L P L S L A A C T N Q ccccacattgtcaactacctgacggagaacccccacaagaaggcggacatgcggcgccaggactcgcgaggcaacacagtgctgcatgcgctggtggcc P H I V N Y L T E N P H K K A D M R R Q D S R G N T V L H A L V A attgctgacaacacccgtgagaacaccaagtttgttaccaagatgtacgacctgctgctgctcaagtgtgcccgcctcttccccgacagcaacctggag I A D N T R E N T K F V T K M Y D L L L L K C A R L F P D S N L E gccgtgctcaacaacgacggcctctcgcccctcatgatggctgccaagacgggcaagattgggatctttcagcacatcatccggcgggaggtgacggat A V L N N D G L S P L M M A A K T G K I G I F Q H I I R R E V T D gaggcggccgctcatcatcaccatcatcattga E A A A H H H H H H - hsV4N wt Avi atggcggattccagcgaaggcccccgcgcggggcccggggaggtggctgagctccccggggatgagagtggcaccccaggtggggaggcttttcctctc M A D S S E G P R A G P G E V A E L P G D E S G T P G G E A F P L tcctccctggccaatctgtttgagggggaggatggctccctttcgccctcaccggctgatgccagtcgccctgctggcccaggcgatgggcgaccaaat S S L A N L F E G E D G S L S P S P A D A S R P A G P G D G R P N ctgcgcatgaagttccagggcgccttccgcaagggggtgcccaaccccatcgatctgctggagtccaccctatatgagtcctcggtggtgcctgggccc L R M K F Q G A F R K G V P N P I D L L E S T L Y E S S V V P G P aagaaagcacccatggactcactgtttgactacggcacctatcgtcaccactccagtgacaacaagaggtggaggaagaagatcatagagaagcagccg K K A P M D S L F D Y G T Y R H H S S D N K R W R K K I I E K Q P cagagccccaaagcccctgcccctcagccgccccccatcctcaaagtcttcaaccggcctatcctctttgacatcgtgtcccggggctccactgctgac Q S P K A P A P Q P P P I L K V F N R P I L F D I V S R G S T A D ctggacgggctgctcccattcttgctgacccacaagaaacgcctaactgatgaggagtttcgagagccatctacggggaagacctgcctgcccaaggcc L D G L L P F L L T H K K R L T D E E F R E P S T G K T C L P K A ttgctgaacctgagcaatggccgcaacgacaccatccctgtgctgctggacatcgcggagcgcaccggcaacatgagggagttcattaactcgcccttc 204 Chapter 6. Appendix L L N L S N G R N D T I P V L L D I A E R T G N M R E F I N S P F cgtgacatctactatcgaggtcagacagccctgcacatcgccattgagcgtcgctgcaaacactacgtggaacttctcgtggcccagggagctgatgtc R D I Y Y R G Q T A L H I A I E R R C K H Y V E L L V A Q G A D V cacgcccaggcccgtgggcgcttcttccagcccaaggatgaggggggctacttctactttggggagctgcccctgtcgctggctgcctgcaccaaccag H A Q A R G R F F Q P K D E G G Y F Y F G E L P L S L A A C T N Q ccccacattgtcaactacctgacggagaacccccacaagaaggcggacatgcggcgccaggactcgcgaggcaacacagtgctgcatgcgctggtggcc P H I V N Y L T E N P H K K A D M R R Q D S R G N T V L H A L V A attgctgacaacacccgtgagaacaccaagtttgttaccaagatgtacgacctgctgctgctcaagtgtgcccgcctcttccccgacagcaacctggag I A D N T R E N T K F V T K M Y D L L L L K C A R L F P D S N L E gccgtgctcaacaacgacggcctctcgcccctcatgatggctgccaagacgggcaagattgggatctttcagcacatcatccggcgggaggtgacggat A V L N N D G L S P L M M A A K T G K I G I F Q H I I R R E V T D gaggcggccgctggcctgaacgatatttttgaagcgcagaaaattgaatggcatgaacatcatcaccatcatcattga E A A A G L N D I F E A Q K I E W H E H H H H H H - hsV4 ARD wt Avi atgcttcaaccggcctatcctctttgacatcgtgtcccggggctccactgctgac M F N R P I L F D I V S R G S T A D ctggacgggctgctcccattcttgctgacccacaagaaacgcctaactgatgaggagtttcgagagccatctacggggaagacctgcctgcccaaggcc L D G L L P F L L T H K K R L T D E E F R E P S T G K T C L P K A ttgctgaacctgagcaatggccgcaacgacaccatccctgtgctgctggacatcgcggagcgcaccggcaacatgagggagttcattaactcgcccttc L L N L S N G R N D T I P V L L D I A E R T G N M R E F I N S P F cgtgacatctactatcgaggtcagacagccctgcacatcgccattgagcgtcgctgcaaacactacgtggaacttctcgtggcccagggagctgatgtc R D I Y Y R G Q T A L H I A I E R R C K H Y V E L L V A Q G A D V cacgcccaggcccgtgggcgcttcttccagcccaaggatgaggggggctacttctactttggggagctgcccctgtcgctggctgcctgcaccaaccag H A Q A R G R F F Q P K D E G G Y F Y F G E L P L S L A A C T N Q ccccacattgtcaactacctgacggagaacccccacaagaaggcggacatgcggcgccaggactcgcgaggcaacacagtgctgcatgcgctggtggcc P H I V N Y L T E N P H K K A D M R R Q D S R G N T V L H A L V A attgctgacaacacccgtgagaacaccaagtttgttaccaagatgtacgacctgctgctgctcaagtgtgcccgcctcttccccgacagcaacctggag I A D N T R E N T K F V T K M Y D L L L L K C A R L F P D S N L E gccgtgctcaacaacgacggcctctcgcccctcatgatggctgccaagacgggcaagattgggatctttcagcacatcatccggcgggaggtgacggat A V L N N D G L S P L M M A A K T G K I G I F Q H I I R R E V T D gaggcggccgctggcctgaacgatatttttgaagcgcagaaaattgaatggcatgaacatcatcaccatcatcattga E A A A G L N D I F E A Q K I E W H E H H H H H H - hsV4 ARD R232C Avi atgcttcaaccggcctatcctctttgacatcgtgtcccggggctccactgctgac M F N R P I L F D I V S R G S T A D ctggacgggctgctcccattcttgctgacccacaagaaacgcctaactgatgaggagtttcgagagccatctacggggaagacctgcctgcccaaggcc L D G L L P F L L T H K K R L T D E E F R E P S T G K T C L P K A ttgctgaacctgagcaatggccgcaacgacaccatccctgtgctgctggacatcgcggagcgcaccggcaacatgagggagttcattaactcgcccttc L L N L S N G R N D T I P V L L D I A E R T G N M R E F I N S P F tgtgacatctactatcgaggtcagacagccctgcacatcgccattgagcgtcgctgcaaacactacgtggaacttctcgtggcccagggagctgatgtc C D I Y Y R G Q T A L H I A I E R R C K H Y V E L L V A Q G A D V cacgcccaggcccgtgggcgcttcttccagcccaaggatgaggggggctacttctactttggggagctgcccctgtcgctggctgcctgcaccaaccag 205 Chapter 6. Appendix H A Q A R G R F F Q P K D E G G Y F Y F G E L P L S L A A C T N Q ccccacattgtcaactacctgacggagaacccccacaagaaggcggacatgcggcgccaggactcgcgaggcaacacagtgctgcatgcgctggtggcc P H I V N Y L T E N P H K K A D M R R Q D S R G N T V L H A L V A attgctgacaacacccgtgagaacaccaagtttgttaccaagatgtacgacctgctgctgctcaagtgtgcccgcctcttccccgacagcaacctggag I A D N T R E N T K F V T K M Y D L L L L K C A R L F P D S N L E gccgtgctcaacaacgacggcctctcgcccctcatgatggctgccaagacgggcaagattgggatctttcagcacatcatccggcgggaggtgacggat A V L N N D G L S P L M M A A K T G K I G I F Q H I I R R E V T D gaggcggccgctggcctgaacgatatttttgaagcgcagaaaattgaatggcatgaacatcatcaccatcatcattga E A A A G L N D I F E A Q K I E W H E H H H H H H - hsV4 ARD K276E Avi atgcttcaaccggcctatcctctttgacatcgtgtcccggggctccactgctgac M F N R P I L F D I V S R G S T A D ctggacgggctgctcccattcttgctgacccacaagaaacgcctaactgatgaggagtttcgagagccatctacggggaagacctgcctgcccaaggcc L D G L L P F L L T H K K R L T D E E F R E P S T G K T C L P K A ttgctgaacctgagcaatggccgcaacgacaccatccctgtgctgctggacatcgcggagcgcaccggcaacatgagggagttcattaactcgcccttc L L N L S N G R N D T I P V L L D I A E R T G N M R E F I N S P F cgtgacatctactatcgaggtcagacagccctgcacatcgccattgagcgtcgctgcaaacactacgtggaacttctcgtggcccagggagctgatgtc R D I Y Y R G Q T A L H I A I E R R C K H Y V E L L V A Q G A D V cacgcccaggcccgtgggcgcttcttccagcccaaggatgaggggggctacttctactttggggagctgcccctgtcgctggctgcctgcaccaaccag H A Q A R G R F F Q P E D E G G Y F Y F G E L P L S L A A C T N Q ccccacattgtcaactacctgacggagaacccccacaagaaggcggacatgcggcgccaggactcgcgaggcaacacagtgctgcatgcgctggtggcc P H I V N Y L T E N P H K K A D M R R Q D S R G N T V L H A L V A attgctgacaacacccgtgagaacaccaagtttgttaccaagatgtacgacctgctgctgctcaagtgtgcccgcctcttccccgacagcaacctggag I A D N T R E N T K F V T K M Y D L L L L K C A R L F P D S N L E gccgtgctcaacaacgacggcctctcgcccctcatgatggctgccaagacgggcaagattgggatctttcagcacatcatccggcgggaggtgacggat A V L N N D G L S P L M M A A K T G K I G I F Q H I I R R E V T D gaggcggccgctggcctgaacgatatttttgaagcgcagaaaattgaatggcatgaacatcatcaccatcatcattga E A A A G L N D I F E A Q K I E W H E H H H H H H - BirA ligase atgaaggataacaccgtgccactgaaattgattgccctgttagcgaacggtgaatttcactctggcgagcagttgggtgaaacgctgggaatgagccgg M K D N T V P L K L I A L L A N G E F H S G E Q L G E T L G M S R gcggctattaataaacacattcagacactgcgtgactggggcgttgatgtctttaccgttccgggtaaaggatacagcctgcctgagcctatccagtta A A I N K H I Q T L R D W G V D V F T V P G K G Y S L P E P I Q L cttaatgctaaacagatattgggtcagctggatggcggtagtgtagccgtgctgccagtgattgactccacgaatcagtaccttcttgatcgtatcgga L N A K Q I L G Q L D G G S V A V L P V I D S T N Q Y L L D R I G gagcttaaatcgggcgatgcttgcattgcagaataccagcaggctggccgtggtcgccggggtcggaaatggttttcgccttttggcgcaaacttatat E L K S G D A C I A E Y Q Q A G R G R R G R K W F S P F G A N L Y ttgtcgatgttctggcgtctggaacaaggcccggcggcggcgattggtttaagtctggttatcggtatcgtgatggcggaagtattacgcaagctgggt L S M F W R L E Q G P A A A I G L S L V I G I V M A E V L R K L G gcagataaagttcgtgttaaatggcctaatgacctctatctgcaggatcgcaagctggcaggcattctggtggagctgactggcaaaactggcgatgcg A D K V R V K W P N D L Y L Q D R K L A G I L V E L T G K T G D A gcgcaaatagtcattggagccgggatcaacatggcaatgcgccgtgttgaagagagtgtcgttaatcaggggtggatcacgctgcaggaagcggggatc 206 Chapter 6. Appendix A Q I V I G A G I N M A M R R V E E S V V N Q G W I T L Q E A G I aatctcgatcgtaatacgttggcggccatgttaatacgtgaattacgtgctgcgttggaactcttcgaacaagaaggattggcaccttatctgtcgcgc N L D R N T L A A M L I R E L R A A L E L F E Q E G L A P Y L S R tgggaaaagctggataattttattaatcgcccagtgaaacttatcattggtgataaagaaatatttggcatttcacgcggaatagacaaacagggggct W E K L D N F I N R P V K L I I G D K E I F G I S R G I D K Q G A ttattacttgagcaggatggaataataaaaccctggatgggcggtgaaatatccctgcgtagtgcagaaaaaggtggtctcgagtga L L L E Q D G I I K P W M G G E I S L R S A E K G G L E - hsV4 ARD+PRR atgaaagcccctgcccctcagccgccccccatcctcaaagtcttcaaccggcctatcctctttgacatcgtgtcccggggctccactgctgacctggac M K A P A P Q P P P I L K V F N R P I L F D I V S R G S T A D L D gggctgctcccattcttgctgacccacaagaaacgcctaactgatgaggagtttcgagagccatctacggggaagacctgcctgcccaaggccttgctg G L L P F L L T H K K R L T D E E F R E P S T G K T C L P K A L L aacctgagcaatggccgcaacgacaccatccctgtgctgctggacatcgcggagcgcaccggcaacatgagggagttcattaactcgcccttccgtgac N L S N G R N D T I P V L L D I A E R T G N M R E F I N S P F R D atctactatcgaggtcagacagccctgcacatcgccattgagcgtcgctgcaaacactacgtggaacttctcgtggcccagggagctgatgtccacgcc I Y Y R G Q T A L H I A I E R R C K H Y V E L L V A Q G A D V H A caggcccgtgggcgcttcttccagcccaaggatgaggggggctacttctactttggggagctgcccctgtcgctggctgcctgcaccaaccagccccac Q A R G R F F Q P K D E G G Y F Y F G E L P L S L A A C T N Q P H attgtcaactacctgacggagaacccccacaagaaggcggacatgcggcgccaggactcgcgaggcaacacagtgctgcatgcgctggtggccattgct I V N Y L T E N P H K K A D M R R Q D S R G N T V L H A L V A I A gacaacacccgtgagaacaccaagtttgttaccaagatgtacgacctgctgctgctcaagtgtgcccgcctcttccccgacagcaacctggaggccgtg D N T R E N T K F V T K M Y D L L L L K C A R L F P D S N L E A V ctcaacaacgacggcctctcgcccctcatgatggctgccaagacgggcaagattgggatctttcagcacatcatccggcgggaggtgacggatgaggcg L N N D G L S P L M M A A K T G K I G I F Q H I I R R E V T D E A gccgctcatcatcaccatcatcattga A A H H H H H H - hsV4 ARD wt atgctcaaagtcttcaaccggcctatcctctttgacatcgtgtcccggggctccactgctgacctggacgggctgctcccattcttgctgacccacaag M L K V F N R P I L F D I V S R G S T A D L D G L L P F L L T H K aaacgcctaactgatgaggagtttcgagagccatctacggggaagacctgcctgcccaaggccttgctgaacctgagcaatggccgcaacgacaccatc K R L T D E E F R E P S T G K T C L P K A L L N L S N G R N D T I cctgtgctgctggacatcgcggagcgcaccggcaacatgagggagttcattaactcgcccttccgtgacatctactatcgaggtcagacagccctgcac P V L L D I A E R T G N M R E F I N S P F R D I Y Y R G Q T A L H atcgccattgagcgtcgctgcaaacactacgtggaacttctcgtggcccagggagctgatgtccacgcccaggcccgtgggcgcttcttccagcccaag I A I E R R C K H Y V E L L V A Q G A D V H A Q A R G R F F Q P K gatgaggggggctacttctactttggggagctgcccctgtcgctggctgcctgcaccaaccagccccacattgtcaactacctgacggagaacccccac D E G G Y F Y F G E L P L S L A A C T N Q P H I V N Y L T E N P H aagaaggcggacatgcggcgccaggactcgcgaggcaacacagtgctgcatgcgctggtggccattgctgacaacacccgtgagaacaccaagtttgtt K K A D M R R Q D S R G N T V L H A L V A I A D N T R E N T K F V accaagatgtacgacctgctgctgctcaagtgtgcccgcctcttccccgacagcaacctggaggccgtgctcaacaacgacggcctctcgcccctcatg T K M Y D L L L L K C A R L F P D S N L E A V L N N D G L S P L M atggctgccaagacgggcaagattgggatctttcagcacatcatccggcgggaggtgacggatgaggcggccgctcatcatcaccatcatcattga 207 Chapter 6. Appendix M A A K T G K I G I F Q H I I R R E V T D E A A A H H H H H H - hsDDX3X_aa122-582 acc atg aaa cat cac cat cac cat cac ccc atg M K H H H H H H P M agc gat tac gac atc ccc act act gag aat ctt tat ttt cag ggc ggc aac agc cgc tgg S D Y D I P T T E N L Y F Q G G N S R W tgc gat aaa agc gat gag gat gac tgg agc aag ccg ctg ccg ccg agc gaa cgc ctg gag C D K S D E D D W S K P L P P S E R L E caa gaa ctg ttt agc ggt ggt aac acc ggt att aac ttt gaa aag tac gac gat atc ccg Q E L F S G G N T G I N F E K Y D D I P gtg gag gcg acc ggt aac aac tgc ccg ccg cac att gaa agc ttc agc gac gtt gag atg V E A T G N N C P P H I E S F S D V E M ggt gaa atc att atg ggc aac atc gag ctg acc cgt tat acc cgt ccg acc ccg gtg cag G E I I M G N I E L T R Y T R P T P V Q aag cat gcg att ccg atc att aag gaa aaa cgt gac ctg atg gcg tgc gcg cag acc ggt K H A I P I I K E K R D L M A C A Q T G agc ggt aaa acc gcg gcg ttt ctg ctg ccg atc ctg agc caa att tat agc gat ggt ccg S G K T A A F L L P I L S Q I Y S D G P ggt gaa gcg ctg cgt gcg atg aag gaa aac ggt cgt tac ggc cgt cgt aaa cag tat ccg G E A L R A M K E N G R Y G R R K Q Y P atc agc ctg gtg ctg gcg ccg acc cgt gag ctg gcg gtt caa att tac gag gaa gcg cgt I S L V L A P T R E L A V Q I Y E E A R aaa ttc agc tat cgt agc cgt gtg cgt ccg tgc gtg gtt tac ggt ggc gcg gac atc ggt K F S Y R S R V R P C V V Y G G A D I G cag caa att cgt gat ctg gaa cgt ggc tgc cac ctg ctg gtt gcg acc ccg ggt cgt ctg Q Q I R D L E R G C H L L V A T P G R L gtt gac atg atg gag cgt ggc aag atc ggc ctg gat ttc tgc aaa tat ctg gtt ctg gac V D M M E R G K I G L D F C K Y L V L D gaa gcg gat cgt atg ctg gac atg ggc ttt gag ccg cag atc cgt cgt att gtg gaa caa E A D R M L D M G F E P Q I R R I V E Q gat acc atg ccg cca aag ggt gtt cgt cac acc atg atg ttc agc gcg acc ttt ccg aaa D T M P P K G V R H T M M F S A T F P K gag atc cag atg ctg gcg cgt gac ttc ctg gat gaa tac att ttt ctg gcg gtg ggt cgt E I Q M L A R D F L D E Y I F L A V G R gtt ggc agc acc agc gag aac atc acc caa aag gtg gtt tgg gtg gag gaa agc gac aaa V G S T S E N I T Q K V V W V E E S D K cgt agc ttt ctg ctg gat ctg ctg aac gcg acc ggc aag gac agc ctg acc ctg gtg ttc R S F L L D L L N A T G K D S L T L V F gtt gaa acc aag aaa ggt gct gac agc ctg gag gat ttt ctg tac cac gaa ggt tat gcg V E T K K G A D S L E D F L Y H E G Y A tgc acc agc atc cac ggc gac cgt agc cag cgt gat cgt gag gaa gcg ctg cac caa ttc C T S I H G D R S Q R D R E E A L H Q F cgt agc ggc aag agc ccg att ctg gtg gcg acc gcg gtt gcg gcg cgt ggt ctg gat atc R S G K S P I L V A T A V A A R G L D I agc aac gtg aaa cac gtt att aac ttt gac ctg ccg agc gat atc gag gaa tat gtg cac 208 Chapter 6. Appendix S N V K H V I N F D L P S D I E E Y V H cgt att ggt cgt acc ggc cgt gtt ggt aac ctg ggc ctg gcg acc agc ttc ttt aac gag R I G R T G R V G N L G L A T S F F N E cgt aac atc aac att acc aaa gac ctg ctg gat ctg ctg gtt gaa gcg aag caa gag gtg R N I N I T K D L L D L L V E A K Q E V ccg agc tgg ctg gag aat atg gcg tat gag cat cac tac aag ggc tga P S W L E N M A Y E H H Y K G - hsDDX3X atg gcc gga aaa cct atc cct aac cct ctg ctg ggg ctg gac tca acc gaa ctg M A G K P I P N P L L G L D S T E L att acc tct ctg tat aag aag gct gga act atg tcc cac gtg gca gtg gag aac gca ctg I T S L Y K K A G T M S H V A V E N A L ggc ctg gac cag cag ttc gca ggc ctg gac ctg aac agc tcc gat aat cag tct gga ggc G L D Q Q F A G L D L N S S D N Q S G G agc acc gcc tcc aag ggc agg tac atc ccc cct cac ctg cgg aat aga gag gcc aca aag S T A S K G R Y I P P H L R N R E A T K ggc ttc tat gac aag gat tct agc ggc tgg tcc tct agc aag gac aag gat gcc tac tcc G F Y D K D S S G W S S S K D K D A Y S tct ttt ggc tct agg agc gac tcc cgc ggc aag agc tcc ttc ttt tcc gat agg ggc tct S F G S R S D S R G K S S F F S D R G S ggc agc agg ggc cgc ttt gac gat agg ggc aga agc gac tat gat ggc atc ggc tcc aga G S R G R F D D R G R S D Y D G I G S R ggc gac agg tct ggc ttc ggc aag ttt gag agg gga gga aac agc agg tgg tgc gac aag G D R S G F G K F E R G G N S R W C D K tcc gat gag gac gat tgg tct aag cca ctg cca cca agc gag cgg ctg gag cag gag ctg S D E D D W S K P L P P S E R L E Q E L ttc agc gga ggc aac acc ggc atc aat ttt gag aag tac gac gat atc ccc gtg gag gcc F S G G N T G I N F E K Y D D I P V E A aca ggc aac aat tgt cct cca cac atc gag tcc ttc tct gat gtg gag atg ggc gag atc T G N N C P P H I E S F S D V E M G E I atc atg ggc aac atc gag ctg acc cgc tat aca cgg cca acc ccc gtg cag aag cac gcc I M G N I E L T R Y T R P T P V Q K H A atc cct atc atc aag gag aag cgg gac ctg atg gca tgc gca cag aca ggc tcc ggc aag I P I I K E K R D L M A C A Q T G S G K acc gca gcc ttt ctg ctg ccc atc ctg agc cag atc tac tcc gat gga cct gga gag gcc T A A F L L P I L S Q I Y S D G P G E A ctg agg gca atg aag gag aat ggc cgc tac ggc cgg aga aag cag tat cct atc agc ctg L R A M K E N G R Y G R R K Q Y P I S L gtg ctg gcc cca acc agg gag ctg gcc gtg cag atc tac gag gag gcc cgc aag ttc tct V L A P T R E L A V Q I Y E E A R K F S tat agg agc cgc gtg cgg cct tgc gtg gtg tac gga gga gca gac atc gga cag cag atc Y R S R V R P C V V Y G G A D I G Q Q I cgg gat ctg gag aga ggc tgt cac ctg ctg gtg gca acc cca ggc cgg ctg gtg gac atg R D L E R G C H L L V A T P G R L V D M atg gag aga ggc aag atc ggc ctg gat ttc tgt aag tat ctg gtg ctg gac gag gcc gat 209 Chapter 6. Appendix M E R G K I G L D F C K Y L V L D E A D cgg atg ctg gac atg ggc ttt gag ccc cag atc agg cgc atc gtg gag cag gat aca atg R M L D M G F E P Q I R R I V E Q D T M ccc cct aag ggc gtg aga cac aca atg atg ttc agc gcc acc ttt cct aag gag atc cag P P K G V R H T M M F S A T F P K E I Q atg ctg gcc cgg gac ttc ctg gat gag tac atc ttt ctg gcc gtg ggc aga gtg ggc agc M L A R D F L D E Y I F L A V G R V G S aca tcc gag aac atc acc cag aag gtg gtg tgg gtg gag gag tct gac aag cgg agc ttt T S E N I T Q K V V W V E E S D K R S F ctg ctg gat ctg ctg aat gcc aca ggc aag gac tcc ctg acc ctg gtg ttc gtg gag aca L L D L L N A T G K D S L T L V F V E T aag aag ggc gcc gac tct ctg gag gat ttt ctg tac cac gag ggc tat gca tgc acc tcc K K G A D S L E D F L Y H E G Y A C T S atc cac ggc gac cgg agc cag aga gat agg gag gag gcc ctg cac cag ttc cgc tcc ggc I H G D R S Q R D R E E A L H Q F R S G aag tct cca atc ctg gtg gca aca gca gtg gca gca agg ggc ctg gat atc tct aac gtg K S P I L V A T A V A A R G L D I S N V aag cac gtg atc aat ttt gac ctg ccc agc gat atc gag gag tat gtg cac aga atc gga K H V I N F D L P S D I E E Y V H R I G agg acc gga agg gtg gga aac ctg ggc ctg gcc aca tcc ttc ttt aac gag aga aac atc R T G R V G N L G L A T S F F N E R N I aac atc acc aag gac ctg ctg gat ctg ctg gtg gag gcc aag cag gag gtg ccc agc tgg N I T K D L L D L L V E A K Q E V P S W ctg gag aat atg gcc tac gag cac cac tat aag ggc tct agc agg ggc cgg agc aag tcc L E N M A Y E H H Y K G S S R G R S K S tct agg ttc tcc gga gga ttt gga gca agg gac tac aga cag agc tcc gga gcc tct agc S R F S G G F G A R D Y R Q S S G A S S tcc tct ttc agc tcc tct cgg gcc agc tcc tct aga agc ggc ggc ggc ggc cac ggc agc S S F S S S R A S S S R S G G G G H G S tcc cgc ggc ttc ggc ggc ggc ggc tat ggc ggc ttt tac aac tca gac ggc tac gga ggg S R G F G G G G Y G G F Y N S D G Y G G aac tac aac tca cag ggc gtg gac tgg tgg gga aac tag N Y N S Q G V D W W G N - eGFP atgagcaaaggcgaagaactgtttaccggcgtggtgccgattctggtggaactggatggcgatgtgaacggccataaatttagcgtgagcggcgaaggc M S K G E E L F T G V V P I L V E L D G D V N G H K F S V S G E G gaaggcgatgcgacctatggcaaactgaccctgaaatttatttgcaccaccggcaaactgccggtgccgtggccgaccctggtgaccacctttagctat E G D A T Y G K L T L K F I C T T G K L P V P W P T L V T T F S Y ggcgtgcagtgctttagccgctatccggatcatatgaaacagcatgatttttttaaaagcgcgatgccggaaggctatgtgcaggaacgcaccattttt G V Q C F S R Y P D H M K Q H D F F K S A M P E G Y V Q E R T I F tttaaagatgatggcaactataaaacccgcgcggaagtgaaatttgaaggcgataccctggtgaaccgcattgaactgaaaggcattgattttaaagaa F K D D G N Y K T R A E V K F E G D T L V N R I E L K G I D F K E gatggcaacattctgggccataaactggaatataactataacagccataacgtgtatattatggcggataaacagaaaaacggcattaaagtgaacttt D G N I L G H K L E Y N Y N S H N V Y I M A D K Q K N G I K V N F aaaattcgccataacattgaagatggcagcgtgcagctggcggatcattatcagcagaacaccccgattggcgatggcccggtgctgctgccggataac 210 Chapter 6. Appendix K I R H N I E D G S V Q L A D H Y Q Q N T P I G D G P V L L P D N cattatctgagcacccagagcgcgctgagcaaagatccgaacgaaaaacgcgatcatatggtgctgctggaatttgtgaccgcggcgggcattacccat H Y L S T Q S A L S K D P N E K R D H M V L L E F V T A A G I T H ggcatggatgaactgtataaa G M D E L Y K hsTRPV4-cGFP atg gcg gat tcc agc gaa ggc ccc cgc gcg ggg ccc ggg gag gtg gct gag ctc ccc ggg M A D S S E G P R A G P G E V A E L P G gat gag agt ggc acc cca ggt ggg gag gct ttt cct ctc tcc tcc ctg gcc aat ctg ttt D E S G T P G G E A F P L S S L A N L F gag ggg gag gat ggc tcc ctt tcg ccc tca ccg gct gat gcc agt cgc cct gct ggc cca E G E D G S L S P S P A D A S R P A G P ggc gat ggg cga cca aat ctg cgc atg aag ttc cag ggc gcc ttc cgc aag ggg gtg ccc G D G R P N L R M K F Q G A F R K G V P aac ccc atc gat ctg ctg gag tcc acc cta tat gag tcc tcg gtg gtg cct ggg ccc aag N P I D L L E S T L Y E S S V V P G P K aaa gca ccc atg gac tca ctg ttt gac tac ggc acc tat cgt cac cac tcc agt gac aac K A P M D S L F D Y G T Y R H H S S D N aag agg tgg agg aag aag atc ata gag aag cag ccg cag agc ccc aaa gcc cct gcc cct K R W R K K I I E K Q P Q S P K A P A P cag ccg ccc ccc atc ctc aaa gtc ttc aac cgg cct atc ctc ttt gac atc gtg tcc cgg Q P P P I L K V F N R P I L F D I V S R ggc tcc act gct gac ctg gac ggg ctg ctc cca ttc ttg ctg acc cac aag aaa cgc cta G S T A D L D G L L P F L L T H K K R L act gat gag gag ttt cga gag cca tct acg ggg aag acc tgc ctg ccc aag gcc ttg ctg T D E E F R E P S T G K T C L P K A L L aac ctg agc aat ggc cgc aac gac acc atc cct gtg ctg ctg gac atc gcg gag cgc acc N L S N G R N D T I P V L L D I A E R T ggc aac atg agg gag ttc att aac tcg ccc ttc cgt gac atc tac tat cga ggt cag aca G N M R E F I N S P F R D I Y Y R G Q T gcc ctg cac atc gcc att gag cgt cgc tgc aaa cac tac gtg gaa ctt ctc gtg gcc cag A L H I A I E R R C K H Y V E L L V A Q gga gct gat gtc cac gcc cag gcc cgt ggg cgc ttc ttc cag ccc aag gat gag ggg ggc G A D V H A Q A R G R F F Q P K D E G G tac ttc tac ttt ggg gag ctg ccc ctg tcg ctg gct gcc tgc acc aac cag ccc cac att Y F Y F G E L P L S L A A C T N Q P H I gtc aac tac ctg acg gag aac ccc cac aag aaa gcc gac atg agg agg cag gac agc agg V N Y L T E N P H K K A D M R R Q D S R ggc aac acc gtg ctg cac gcc ctg gtg gcc atc gcc gac aac acc agg gag aac acc aag G N T V L H A L V A I A D N T R E N T K ttc gtg acc aag atg tac gac ctg ctg ctg ctg aag tgc gcc agg ctg ttc ccc gac agc F V T K M Y D L L L L K C A R L F P D S aac ctg gag gcc gtg ctg aac aac gac ggc ctg agc ccc ctg atg atg gcc gcc aag acc N L E A V L N N D G L S P L M M A A K T ggc aag att ggg atc ttt cag cac atc atc cgg cgg gag gtg acg gat gag gac aca cgg 211 Chapter 6. Appendix G K I G I F Q H I I R R E V T D E D T R cac ctg tcc cgc aag ttc aag gac tgg gcc tat ggg cca gtg tat tcc tcg ctt tat gac H L S R K F K D W A Y G P V Y S S L Y D ctc tcc tcc ctg gac acg tgt ggg gaa gag gcc tcc gtg ctg gag atc ctg gtg tac aac L S S L D T C G E E A S V L E I L V Y N agc aag att gag aac cgc cac gag atg ctg gct gtg gag ccc atc aat gaa ctg ctg cgg S K I E N R H E M L A V E P I N E L L R gac aag tgg cgc aag ttc ggg gcc gtc tcc ttc tac atc aac gtg gtc tcc tac ctg tgt D K W R K F G A V S F Y I N V V S Y L C gcc atg gtc atc ttc act ctc acc gcc tac tac cag ccg ctg gag ggc aca ccg ccg tac A M V I F T L T A Y Y Q P L E G T P P Y cct tac cgc acc acg gtg gac tac ctg cgg ctg gct ggc gag gtc att acg ctc ttc act P Y R T T V D Y L R L A G E V I T L F T ggg gtc ctg ttc ttc ttc acc aac atc aaa gac ttg ttc atg aag aaa tgc cct gga gtg G V L F F F T N I K D L F M K K C P G V aat tct ctc ttc att gat ggc tcc ttc cag ctg ctc tac ttc atc tac tct gtc ctg gtg N S L F I D G S F Q L L Y F I Y S V L V atc gtc tca gca gcc ctc tac ctg gca ggg atc gag gcc tac ctg gcc gtg atg gtc ttt I V S A A L Y L A G I E A Y L A V M V F gcc ctg gtc ctg ggc tgg atg aat gcc ctt tac ttc acc cgt ggg ctg aag ctg acg ggg A L V L G W M N A L Y F T R G L K L T G acc tat agc atc atg atc cag aag att ctc ttc aag gac ctt ttc cga ttc ctg ctc gtc T Y S I M I Q K I L F K D L F R F L L V tac ttg ctc ttc atg atc ggc tac gct tca gcc ctg gtc tcc ctc ctg aac ccg tgt gcc Y L L F M I G Y A S A L V S L L N P C A aac atg aag gtg tgc aat gag gac cag acc aac tgc aca gtg ccc act tac ccc tcg tgc N M K V C N E D Q T N C T V P T Y P S C cgt gac agc gag acc ttc agc acc ttc ctc ctg gac ctg ttt aag ctg acc atc ggc atg R D S E T F S T F L L D L F K L T I G M ggc gac ctg gag atg ctg agc agc acc aag tac ccc gtg gtc ttc atc atc ctg ctg gtg G D L E M L S S T K Y P V V F I I L L V acc tac atc atc ctc acc ttt gtg ctg ctc ctc aac atg ctc att gcc ctc atg ggc gag T Y I I L T F V L L L N M L I A L M G E aca gtg ggc cag gtc tcc aag gag agc aag cac atc tgg aag ctg cag tgg gcc acc acc T V G Q V S K E S K H I W K L Q W A T T atc ctg gac att gag cgc tcc ttc ccc gta ttc ctg agg aag gcc ttc cgc tct ggg gag I L D I E R S F P V F L R K A F R S G E atg gtc acc gtg ggc aag agc tcg gac ggc act cct gac cgc agg tgg tgc ttc agg gtg M V T V G K S S D G T P D R R W C F R V gat gag gtg aac tgg tct cac tgg aac cag aac ttg ggc atc atc aac gag gac ccg ggc D E V N W S H W N Q N L G I I N E D P G aag aat gag acc tac cag tat tat ggc ttc tcg cat acc gtg ggc cgc ctc cgc agg gat K N E T Y Q Y Y G F S H T V G R L R R D cgc tgg tcc tcg gtg gta ccc cgc gtg gtg gaa ctg aac aag aac tcg aac ccg gac gag R W S S V V P R V V E L N K N S N P D E gtg gtg gtg cct ctg gac agc atg ggg aac ccc cgc tgc gat ggc cac cag cag ggt tac V V V P L D S M G N P R C D G H Q Q G Y ccc cgc aag tgg agg act gat gac gcc ccg ctc atg gtg tgc aag tat gag gag ctg ttc 212 Chapter 6. Appendix P R K W R T D D A P L M V C K Y E E L F acc ggg gtg gtg ccc atc ctg gtc gag ctg gac ggc gac gta aac ggc cac aag ttc agc T G V V P I L V E L D G D V N G H K F S gtg tcc ggc gag agc gag ggc gat gcc acg tac ggc aag ctg acc atg aag ttc atc tgc V S G E S E G D A T Y G K L T M K F I C acc acc ggc aag ctg ccc gtg ccc tgg ccc acc ctc gtg acc acc ctg acg tac ggc gtg T T G K L P V P W P T L V T T L T Y G V cag tgc ttc agc cgc tac ccc gac cac atg aag cag cac gac ttc ttc aag tcc gcc atg Q C F S R Y P D H M K Q H D F F K S A M ccc gaa ggc tac gtc cag gag cgc acc atc ttc ttc aag gat gac ggc aac tac aag acc P E G Y V Q E R T I F F K D D G N Y K T cgc gcc gag gtg aag ttc gag ggc gac acc ctg gtg aac cgc atc gag ctg aag ggc atc R A E V K F E G D T L V N R I E L K G I gac ttc aag gag gac ggc aac atc ctg ggg cac aag ctg gag tac aac tac aac agc cac D F K E D G N I L G H K L E Y N Y N S H aac gtc tat atc atg gcc gac aag cag aag aac ggc atc aag gtg aac ttc aag atc cgc N V Y I M A D K Q K N G I K V N F K I R cac aac atc gag gac ggc agc gtg cag ctc gcc gac cac tac cag cag aac acc ccc atc H N I E D G S V Q L A D H Y Q Q N T P I ggc gac ggc ccc gtg ctg ctg ccc gac aac cac tac ctg agc acc cag tcc aag ctg agc G D G P V L L P D N H Y L S T Q S K L S aaa gac ccc aac gag aag cgc gat cac atg gtc ctg ctg gag ttc gtg acc gcc gcc ggg K D P N E K R D H M V L L E F V T A A G atc act ctc ggc atg gac gag ctg tac aag tag I T L G M D E L Y K - hsTRPV4 R232C-cGFP see hsTRPV4-cGFP, c.694C>T, p. Arg232C hsTRPV4 R269C-cGFP see hsTRPV4-cGFP, c.805C>T, p. Arg269C hsTRPV4-cFLAG atg gcg gat tcc agc gaa ggc ccc cgc gcg ggg ccc M A D S S E G P R A G P ggg gag gtg gct gag ctc ccc ggg gat gag agt ggc acc cca ggt ggg gag gct ttt cct G E V A E L P G D E S G T P G G E A F P ctc tcc tcc ctg gcc aat ctg ttt gag ggg gag gat ggc tcc ctt tcg ccc tca ccg gct L S S L A N L F E G E D G S L S P S P A gat gcc agt cgc cct gct ggc cca ggc gat ggg cga cca aat ctg cgc atg aag ttc cag D A S R P A G P G D G R P N L R M K F Q 213 Chapter 6. Appendix ggc gcc ttc cgc aag ggg gtg ccc aac ccc atc gat ctg ctg gag tcc acc cta tat gag G A F R K G V P N P I D L L E S T L Y E tcc tcg gtg gtg cct ggg ccc aag aaa gca ccc atg gac tca ctg ttt gac tac ggc acc S S V V P G P K K A P M D S L F D Y G T tat cgt cac cac tcc agt gac aac aag agg tgg agg aag aag atc ata gag aag cag ccg Y R H H S S D N K R W R K K I I E K Q P cag agc ccc aaa gcc cct gcc cct cag ccg ccc ccc atc ctc aaa gtc ttc aac cgg cct Q S P K A P A P Q P P P I L K V F N R P atc ctc ttt gac atc gtg tcc cgg ggc tcc act gct gac ctg gac ggg ctg ctc cca ttc I L F D I V S R G S T A D L D G L L P F ttg ctg acc cac aag aaa cgc cta act gat gag gag ttt cga gag cca tct acg ggg aag L L T H K K R L T D E E F R E P S T G K acc tgc ctg ccc aag gcc ttg ctg aac ctg agc aat ggc cgc aac gac acc atc cct gtg T C L P K A L L N L S N G R N D T I P V ctg ctg gac atc gcg gag cgc acc ggc aac atg agg gag ttc att aac tcg ccc ttc cgt L L D I A E R T G N M R E F I N S P F R gac atc tac tat cga ggt cag aca gcc ctg cac atc gcc att gag cgt cgc tgc aaa cac D I Y Y R G Q T A L H I A I E R R C K H tac gtg gaa ctt ctc gtg gcc cag gga gct gat gtc cac gcc cag gcc cgt ggg cgc ttc Y V E L L V A Q G A D V H A Q A R G R F ttc cag ccc aag gat gag ggg ggc tac ttc tac ttt ggg gag ctg ccc ctg tcg ctg gct F Q P K D E G G Y F Y F G E L P L S L A gcc tgc acc aac cag ccc cac att gtc aac tac ctg acg gag aac ccc cac aag aaa A C T N Q P H I V N Y L T E N P H K K gcc gac atg agg agg cag gac agc agg ggc aac acc gtg ctg cac gcc ctg gtg gcc A D M R R Q D S R G N T V L H A L V A atc gcc gac aac acc agg gag aac acc aag I A D N T R E N T K ttc gtg acc aag atg tac gac ctg ctg ctg ctg aag tgc gcc agg ctg ttc ccc gac agc F V T K M Y D L L L L K C A R L F P D S aac ctg gag gcc gtg ctg aac aac gac ggc ctg agc ccc ctg atg atg gcc gcc aag acc N L E A V L N N D G L S P L M M A A K T ggc aag att ggg atc ttt cag cac atc atc cgg cgg gag G K I G I F Q H I I R R E gtg acg gat gag gac aca cgg cac ctg tcc cgc aag ttc aag gac tgg gcc tat ggg cca V T D E D T R H L S R K F K D W A Y G P gtg tat tcc tcg ctt tat gac ctc tcc tcc ctg gac acg tgt ggg gaa gag gcc tcc gtg V Y S S L Y D L S S L D T C G E E A S V ctg gag atc ctg gtg tac aac agc aag att gag aac cgc cac gag atg ctg gct gtg gag L E I L V Y N S K I E N R H E M L A V E ccc atc aat gaa ctg ctg cgg gac aag tgg cgc aag ttc ggg gcc gtc tcc ttc tac atc P I N E L L R D K W R K F G A V S F Y I aac gtg gtc tcc tac ctg tgt gcc atg gtc atc ttc act ctc acc gcc tac tac cag ccg N V V S Y L C A M V I F T L T A Y Y Q P ctg gag ggc aca ccg ccg tac cct tac cgc acc acg gtg gac tac ctg cgg ctg gct ggc L E G T P P Y P Y R T T V D Y L R L A G gag gtc att acg ctc ttc act ggg gtc ctg ttc ttc ttc acc aac atc aaa gac ttg ttc E V I T L F T G V L F F F T N I K D L F 214 Chapter 6. Appendix atg aag aaa tgc cct gga gtg aat tct ctc ttc att gat ggc tcc ttc cag ctg ctc tac M K K C P G V N S L F I D G S F Q L L Y ttc atc tac tct gtc ctg gtg atc gtc tca gca gcc ctc tac ctg gca ggg atc gag gcc F I Y S V L V I V S A A L Y L A G I E A tac ctg gcc gtg atg gtc ttt gcc ctg gtc ctg ggc tgg atg aat gcc ctt tac ttc acc Y L A V M V F A L V L G W M N A L Y F T cgt ggg ctg aag ctg acg ggg acc tat agc atc atg atc cag aag att ctc ttc aag gac R G L K L T G T Y S I M I Q K I L F K D ctt ttc cga ttc ctg ctc gtc tac ttg ctc ttc atg atc ggc tac gct tca gcc ctg gtc L F R F L L V Y L L F M I G Y A S A L V tcc ctc ctg aac ccg tgt gcc aac atg aag gtg tgc aat gag gac cag acc aac tgc aca S L L N P C A N M K V C N E D Q T N C T gtg ccc act tac ccc tcg tgc cgt gac agc gag acc ttc agc acc ttc ctc ctg gac ctg V P T Y P S C R D S E T F S T F L L D L ttt aag ctg acc atc ggc atg ggc gac ctg gag atg ctg agc agc acc aag tac ccc F K L T I G M G D L E M L S S T K Y P gtg gtc ttc atc atc ctg ctg gtg acc tac atc atc ctc acc ttt gtg V V F I I L L V T Y I I L T F V ctg ctc ctc aac atg ctc att gcc ctc atg ggc gag aca gtg ggc cag gtc tcc aag gag L L L N M L I A L M G E T V G Q V S K E agc aag cac atc tgg aag ctg cag tgg gcc acc acc atc ctg gac att gag cgc tcc ttc S K H I W K L Q W A T T I L D I E R S F ccc gta ttc ctg agg aag gcc ttc cgc tct ggg gag atg gtc acc gtg ggc aag agc tcg P V F L R K A F R S G E M V T V G K S S gac ggc act cct gac cgc agg tgg tgc ttc agg gtg gat gag gtg aac tgg tct cac tgg D G T P D R R W C F R V D E V N W S H W aac cag aac ttg ggc atc atc aac gag gac ccg ggc aag aat gag acc tac cag tat tat N Q N L G I I N E D P G K N E T Y Q Y Y ggc ttc tcg cat acc gtg ggc cgc ctc cgc agg gat cgc tgg tcc tcg gtg gta ccc cgc G F S H T V G R L R R D R W S S V V P R gtg gtg gaa ctg aac aag aac tcg aac ccg gac gag gtg gtg gtg cct ctg gac agc atg V V E L N K N S N P D E V V V P L D S M ggg aac ccc cgc tgc gat ggc cac cag cag ggt tac ccc cgc aag tgg agg act gat gac G N P R C D G H Q Q G Y P R K W R T D D gcc ccg ctc aat tcg tcg aca agc ttc tcg agc atg cat cta gat gac tat gat gac A P L G N L N S S T S F S S M H L D D tat aaa gac gat gac gac tag Y K D D D K - hsTRPV4 R232C-cFLAG see hsTRPV4-cFLAG, c.694C>T, p. Arg232C 215 Chapter 6. Appendix hsTRPV4 R269C-cFLAG see hsTRPV4-cFLAG, c.805C>T, p. Arg269C hsPACSIN1-nV5 atggcaggcaagccaatccctaaccctctgctgggcctggacagcaccgaattgatcacaagtttgtacaaaaaagcaggcacc M A G K P I P N P L L G L D S T E L I T S L Y K K A G T atg agc agc agc tac gac gag gcc agc ctg gcc ccc gag gag acc acc gac agc ttc tgg M S S S Y D E A S L A P E E T T D S F W gag gtg ggc aac tac aag agg acc gtg aag agg atc gac gac ggc cac agg ctg tgc aac E V G N Y K R T V K R I D D G H R L C N gac ctg atg aac tgc gtg cag gag agg gcc aag atc gag aag gcc tac ggc cag cag ctg D L M N C V Q E R A K I E K A Y G Q Q L acc gac tgg gcc aag agg tgg agg cag ctg atc gag aag ggc ccc cag tac ggc agc ctg T D W A K R W R Q L I E K G P Q Y G S L gag agg gcc tgg ggc gcc atc atg acc gag gcc gac aag gtg agc gag ctg cac cag gag E R A W G A I M T E A D K V S E L H Q E gtg aag aac aac ctg ctg aac gag gac ctg gag aag gtg aag aac tgg cag aag gac gcc V K N N L L N E D L E K V K N W Q K D A tac cac aag cag atc atg ggc ggc ttc aag gag acc aag gag gcc gag gac ggc ttc agg Y H K Q I M G G F K E T K E A E D G F R aag gcc cag aag ccc tgg gcc aag aag atg aag gag ctg gag gcc gcc aag aag gcc tac K A Q K P W A K K M K E L E A A K K A Y cac ctg gcc tgc aag gag gag aag ctg gcc atg acc agg gag atg aac agc aag acc gag H L A C K E E K L A M T R E M N S K T E cag agc gtg acc ccc gag cag cag aag aag ctg cag gac aag gtg gac aag tgc aag cag Q S V T P E Q Q K K L Q D K V D K C K Q gac gtg cag aag acc cag gag aag tac gag aag gtg ctg gag gac gtg ggc aag acc acc D V Q K T Q E K Y E K V L E D V G K T T ccc cag tac atg gag aac atg gag cag gtg ttc gag cag tgc cag cag ttc gag gag aag P Q Y M E N M E Q V F E Q C Q Q F E E K agg ctg gtg ttc ctg aag gag gtg ctg ctg gac atc aag agg cac ctg aac ctg gcc gag R L V F L K E V L L D I K R H L N L A E aac agc agc tac atc cac gtg tac agg gag ctg gag cag gcc atc agg ggc gcc gac gcc N S S Y I H V Y R E L E Q A I R G A D A cag gag gac ctg agg tgg ttc agg agc acc agc ggc ccc ggc atg ccc atg aac tgg ccc Q E D L R W F R S T S G P G M P M N W P cag ttc gag gag tgg aac ccc gac ctg ccc cac acc acc acc aag aag gag aag cag ccc Q F E E W N P D L P H T T T K K E K Q P aag aag gcc gag ggc gtg gcc ctg acc aac gcc acc ggc gcc gtg gag agc acc agc cag K K A E G V A L T N A T G A V E S T S Q gcc ggc gac agg ggc agc gtg agc agc tac gac agg ggc cag ccc tac gcc acc gag tgg A G D R G S V S S Y D R G Q P Y A T E W agc gac gac gag agc ggc aac ccc ttc ggc ggc agc gag acc aac ggc ggc gcc aac ccc S D D E S G N P F G G S E T N G G A N P ttc gag gac gac agc aag ggc gtg agg gtg agg gcc ctg tac gac tac gac ggc cag gag 216 Chapter 6. Appendix F E D D S K G V R V R A L Y D Y D G Q E cag gac gag ctg agc ttc aag gcc ggc gac gag ctg acc aag ctg ggc gag gag gac gag Q D E L S F K A G D E L T K L G E E D E cag ggc tgg tgc agg ggc agg ctg gac agc ggc cag ctg ggc ctg tac ccc gcc aac tac Q G W C R G R L D S G Q L G L Y P A N Y gtg gag gcc atc tag V E A I - hsPACSIN2-nV5 atggcaggcaagccaatccctaaccctctgctgggcctggacagcaccgaattgatcacaagtttgtacaaaaaagcaggc M A G K P I P N P L L G L D S T E L I T S L Y K K A G atg agc gtg acc tac gac gac agc gtg ggc gtg gag gtg agc agc gac agc ttc tgg gag M S V T Y D D S V G V E V S S D S F W E gtg ggc aac tac aag agg acc gtg aag agg atc gac gac ggc cac agg ctg tgc agc gac V G N Y K R T V K R I D D G H R L C S D ctg atg aac tgc ctg cac gag agg gcc agg atc gag aag gcc tac gcc cag cag ctg acc L M N C L H E R A R I E K A Y A Q Q L T gag tgg gcc agg agg tgg agg cag ctg gtg gag aag ggc ccc cag tac ggc acc gtg gag E W A R R W R Q L V E K G P Q Y G T V E aag gcc tgg atg gcc ttc atg agc gag gcc gag agg gtg agc gag ctg cac ctg gag gtg K A W M A F M S E A E R V S E L H L E V aag gcc agc ctg atg aac gac gac ttc gag aag atc aag aac tgg cag aag gag gcc ttc K A S L M N D D F E K I K N W Q K E A F cac aag cag atg atg ggc ggc ttc aag gag acc aag gag gcc gag gac ggc ttc agg aag H K Q M M G G F K E T K E A E D G F R K gcc cag aag ccc tgg gcc aag aag ctg aag gag gtg gag gcc gcc aag aag gcc cac cac A Q K P W A K K L K E V E A A K K A H H gcc gcc tgc aag gag gag aag ctg gcc atc agc agg gag gcc aac agc aag gcc gac ccc A A C K E E K L A I S R E A N S K A D P agc ctg aac ccc gag cag ctg aag aag ctg cag gac aag atc gag aag tgc aag cag gac S L N P E Q L K K L Q D K I E K C K Q D gtg ctg aag acc aag gag aag tac gag aag agc ctg aag gag ctg gac cag ggc acc ccc V L K T K E K Y E K S L K E L D Q G T P cag tac atg gag aac atg gag cag gtg ttc gag cag tgc cag cag ttc gag gag aag agg Q Y M E N M E Q V F E Q C Q Q F E E K R ctg agg ttc ttc agg gag gtg ctg ctg gag gtg cag aag cac ctg gac ctg agc aac gtg L R F F R E V L L E V Q K H L D L S N V gcc ggc tac aag gcc atc tac cac gac ctg gag cag agc atc agg gcc gcc gac gcc gtg A G Y K A I Y H D L E Q S I R A A D A V gag gac ctg agg tgg ttc agg gcc aac cac ggc ccc ggc atg gcc atg aac tgg ccc cag E D L R W F R A N H G P G M A M N W P Q ttc gag gag tgg agc gcc gac ctg aac agg acc ctg agc agg agg gag aag aag aag gcc F E E W S A D L N R T L S R R E K K K A acc gac ggc gtg acc ctg acc ggc atc aac cag acc ggc gac cag agc ctg ccc agc aag T D G V T L T G I N Q T G D Q S L P S K ccc agc agc acc ctg aac gtg ccc agc aac ccc gcc cag agc gcc cag agc cag agc agc 217 Chapter 6. Appendix P S S T L N V P S N P A Q S A Q S Q S S tac aac ccc ttc gag gac gag gac gac acc ggc agc acc gtg agc gag aag gac gac acc Y N P F E D E D D T G S T V S E K D D T aag gcc aag aac gtg agc agc tac gag aag acc cag agc tac ccc acc gac tgg agc gac K A K N V S S Y E K T Q S Y P T D W S D gac gag agc aac aac ccc ttc agc agc acc gac gcc aac ggc gac agc aac ccc ttc gac D E S N N P F S S T D A N G D S N P F D gac gac gcc acc agc ggc acc gag gtg agg gtg agg gcc ctg tac gac tac gag ggc cag D D A T S G T E V R V R A L Y D Y E G Q gag cac gac gag ctg agc ttc aag gcc ggc gac gag ctg acc aag atg gag gac gag gac E H D E L S F K A G D E L T K M E D E D gag cag ggc tgg tgc aag ggc agg ctg gac aac ggc cag gtg ggc ctg tac ccc gcc aac E Q G W C K G R L D N G Q V G L Y P A N tac gtg gag gcc atc cag tag Y V E A I Q - hsPACSIN3-nV5 atggcaggcaagccaatccctaaccctctgctgggcctggacagcaccgaattgatcacaagtttgtacaaaaaagcaggc M A G K P I P N P L L G L D S T E L I T S L Y K K A G atg gcc ccc gag gag gac gcc ggc ggc gag gcc ctg ggc ggc agc ttc tgg gag gcc ggc M A P E E D A G G E A L G G S F W E A G aac tac agg agg acc gtg cag agg gtg gag gac ggc cac agg ctg tgc ggc gac ctg gtg N Y R R T V Q R V E D G H R L C G D L V agc tgc ttc cag gag agg gcc agg atc gag aag gcc tac gcc cag cag ctg gcc gac tgg S C F Q E R A R I E K A Y A Q Q L A D W gcc agg aag tgg agg ggc acc gtg gag aag ggc ccc cag tac ggc acc ctg gag aag gcc A R K W R G T V E K G P Q Y G T L E K A tgg cac gcc ttc ttc acc gcc gcc gag agg ctg agc gcc ctg cac ctg gag gtg agg gag W H A F F T A A E R L S A L H L E V R E aag ctg cag ggc cag gac agc gag agg gtg agg gcc tgg cag agg ggc gcc ttc cac agg K L Q G Q D S E R V R A W Q R G A F H R ccc gtg ctg ggc ggc ttc agg gag agc agg gcc gcc gag gac ggc ttc agg aag gcc cag P V L G G F R E S R A A E D G F R K A Q aag ccc tgg ctg aag agg ctg aag gag gtg gag gcc agc aag aag agc tac cac gcc gcc K P W L K R L K E V E A S K K S Y H A A agg aag gac gag aag acc gcc cag acc agg gag agc cac gcc aag gcc gac agc gcc gtg R K D E K T A Q T R E S H A K A D S A V agc cag gag cag ctg agg aag ctg cag gag agg gtg gag agg tgc gcc aag gag gcc gag S Q E Q L R K L Q E R V E R C A K E A E aag acc aag gcc cag tac gag cag acc ctg gcc gag ctg cac agg tac acc ccc agg tac K T K A Q Y E Q T L A E L H R Y T P R Y atg gag gac atg gag cag gcc ttc gag acc tgc cag gcc gcc gag agg cag agg ctg ctg M E D M E Q A F E T C Q A A E R Q R L L ttc ttc aag gac atg ctg ctg acc ctg cac cag cac ctg gac ctg agc agc agc gag aag F F K D M L L T L H Q H L D L S S S E K ttc cac gag ctg cac agg gac ctg cac cag ggc atc gag gcc gcc agc gac gag gag gac 218 Chapter 6. Appendix F H E L H R D L H Q G I E A A S D E E D ctg agg tgg tgg agg agc acc cac ggc ccc ggc atg gcc atg aac tgg ccc cag ttc gag L R W W R S T H G P G M A M N W P Q F E gag tgg agc ctg gac acc cag agg acc atc agc agg aag gag aag ggc ggc agg agc ccc E W S L D T Q R T I S R K E K G G R S P gac gag gtg acc ctg acc agc atc gtg ccc acc agg gac ggc acc gcc ccc ccc ccc cag D E V T L T S I V P T R D G T A P P P Q agc ccc ggc agc ccc ggc acc ggc cag gac gag gag tgg agc gac gag gag agc ccc agg S P G S P G T G Q D E E W S D E E S P R aag gcc gcc acc ggc gtg agg gtg agg gcc ctg tac gac tac gcc ggc cag gag gcc gac K A A T G V R V R A L Y D Y A G Q E A D gag ctg agc ttc agg gcc ggc gag gag ctg ctg aag atg agc gag gag gac gag cag ggc E L S F R A G E E L L K M S E E D E Q G tgg tgc cag ggc cag ctg cag agc ggc agg atc ggc ctg tac ccc gcc aac tac gtg gag W C Q G Q L Q S G R I G L Y P A N Y V E tgc gtg ggc gcc tag C V G A - PACSIN1+2-nV5 attt aag tgt cat tgg cag att acc acc atg gca ggc aag cca atc cct aac cct ctg ctg F K C H W Q I T T M A G K P I P N P L L ggc ctg gac agc acc gaa ttg atc aca agt ttg tac aaa aaa gca ggc acc atg tcc agc G L D S T E L I T S L Y K K A G T M S S tcc tac gat gag gcc tca ctg gta gaa gtg tcc agc gac agc ttc tgg gag gtc ggg aac S Y D E A S L V E V S S D S F W E V G N tac aag cgg act gtg aag cgg atc gac gat ggc cac cgc ctg tgc agc gac ctc atg aac Y K R T V K R I D D G H R L C S D L M N tgc ctg cat gag cgg gcg cgc atc gag aag gcg tat gcg cag cag ctc act gag tgg gcc C L H E R A R I E K A Y A Q Q L T E W A cgg cgc tgg agg cag ctc gtg gag aaa ggg ccc cag tac ggg acc gtg gag aag gcc tgg R R W R Q L V E K G P Q Y G T V E K A W atg gcc ttc atg tcc gag gca gag agg gtg agc gag ctg cac ctc gag gtg aag gcc tca M A F M S E A E R V S E L H L E V K A S ctg atg aac gat gac ttc gag aag atc aag aac tgg cag aag gaa gcc ttt cac aag cag L M N D D F E K I K N W Q K E A F H K Q atg atg ggc ggc ttc aag gag acc aag gaa gct gag gac ggc ttt cgg aag gca cag aag M M G G F K E T K E A E D G F R K A Q K ccc tgg gcc aag aag ctg aaa gag gta gaa gca gca aag aaa gcc cac cat gca gcg tgc P W A K K L K E V E A A K K A H H A A C aaa gag gag aag ctg gct atc tca cga gaa gcc aac agc aag gca gac cca tcc ctc aac K E E K L A I S R E A N S K A D P S L N cct gaa cag ctc aag aaa ttg caa gac aaa ata gaa aag tgc aag caa gat gtt ctt aag P E Q L K K L Q D K I E K C K Q D V L K acc aaa gag aag tat gag aag tcc ctg aaa gaa ctc gac cag ggc aca ccc cag tac atg T K E K Y E K S L K E L D Q G T P Q Y M gag aac atg gag cag tgt ttg agc agt gcc agc agt tcg agg aga aaa cgc ctt cgc ttc 219 Chapter 6. Appendix E N M E Q C L S S A S S S R R K R L R F ttc cgg gag gtt ctg ctg gag gtt cag aag cac cta gac ctg tcc aat gtg gct ggc tac F R E V L L E V Q K H L D L S N V A G Y aaa gcc att tac cat gac ctg gag cag agc atc aga gca gct gat gca gtg gag gac ctc K A I Y H D L E Q S I R A A D A V E D L aga tgg ttc cgc agc acc agt ggc ccc ggc atg ccc atg aac tgg ccc cag ttt gag gag R W F R S T S G P G M P M N W P Q F E E tgg aac cca gac ctt cct cac acc acc acc aag aag gag aaa cag cct aag aag gca gag W N P D L P H T T T K K E K Q P K K A E gga gtg gcg ctg acc aat gcc act ggg gcg gta gag tcc aca tcc cag gct ggg gac cgc G V A L T N A T G A V E S T S Q A G D R ggc agt gtt agc agc tac gac aga ggc cag ccc tac gcc acc gag tgg tca gac gac gag G S V S S Y D R G Q P Y A T E W S D D E agt ggg aac ccc ttt ggg ggc agt gag acc aac ggg ggc gcc aac ccc ttt gag gac gac S G N P F G G S E T N G G A N P F E D D tcc aag gga gtg cgc gtg cgg gca ctc tac gac tat gac ggc cag gag cag gac gag ctc S K G V R V R A L Y D Y D G Q E Q D E L agc ttt aag gcc gga gac gaa ctc acc aag ctg ggc gag gag gat gag cag ggc tgg tgc S F K A G D E L T K L G E E D E Q G W C cgt ggg cgg ctg gac agc ggg cag ctg ggc ctc tac cct gcc aac tac gtg gag gct atc R G R L D S G Q L G L Y P A N Y V E A I tag aac cca gct - N P A PACSIN1+3-nV5 attt aag tgt cat tgg cag att acc acc atg gca ggc aag cca atc cct aac cct ctg ctg F K C H W Q I T T M A G K P I P N P L L ggc ctg gac agc acc gaa ttg atc aca agt ttg tac aaa aaa gca ggc acc atg tcc agc G L D S T E L I T S L Y K K A G T M S S tcc tac gat gag gcc tca ctg atg gcc ccc gag gag gac gcc ggc ggc gag gcc ctg ggc S Y D E A S L M A P E E D A G G E A L G ggc agc ttc tgg gag gcc ggc aac tac agg agg acc gtg cag agg gtg gag gac ggc cac G S F W E A G N Y R R T V Q R V E D G H agg ctg tgc ggc gac ctg gtg agc tgc ttc cag gag agg gcc agg atc gag aag gcc tac R L C G D L V S C F Q E R A R I E K A Y gcc cag cag ctg gcc gac tgg gcc agg aag tgg agg ggc acc gtg gag aag ggc ccc cag A Q Q L A D W A R K W R G T V E K G P Q tac ggc acc ctg gag aag gcc tgg cac gcc ttc ttc acc gcc gcc gag agg ctg agc gcc Y G T L E K A W H A F F T A A E R L S A ctg cac ctg gag gtg agg gag aag ctg cag ggc cag gac agc gag agg gtg agg gcc tgg L H L E V R E K L Q G Q D S E R V R A W cag agg ggc gcc ttc cac agg ccc gtg ctg ggc ggc ttc agg gag agc agg gcc gcc gag Q R G A F H R P V L G G F R E S R A A E gac ggc ttc agg aag gcc cag aag ccc tgg ctg aag agg ctg aag gag gtg gag gcc agc D G F R K A Q K P W L K R L K E V E A S aag aag agc tac cac gcc gcc agg aag gac gag aag acc gcc cag acc agg gag agc cac 220 Chapter 6. Appendix K K S Y H A A R K D E K T A Q T R E S H gcc aag gcc gac agc gcc gtg agc cag gag cag ctg agg aag ctg cag gag agg gtg gag A K A D S A V S Q E Q L R K L Q E R V E agg tgc gcc aag gag gcc gag aag acc aag gcc cag tac gag cag acc ctg gcc gag ctg R C A K E A E K T K A Q Y E Q T L A E L cac agg tac acc ccc agg tac atg gag gac atg gag cag gcc ttc gag acc tgc cag gcc H R Y T P R Y M E D M E Q A F E T C Q A gcc gag agg cag agg ctg ctg ttc ttc aag gac atg ctg ctg acc ctg cac cag cac ctg A E R Q R L L F F K D M L L T L H Q H L gac ctg agc agc agc gag aag ttc cac gag ctg cac agg gac ctg cac cag ggc atc gag D L S S S E K F H E L H R D L H Q G I E gcc gcc agc gac gag gag gac ctc aga tgg ttc cgc agc acc agt ggc ccc ggc atg ccc A A S D E E D L R W F R S T S G P G M P atg aac tgg ccc cag ttt gag gag tgg aac cca gac ctt cct cac acc acc acc aag aag M N W P Q F E E W N P D L P H T T T K K gag aaa cag cct aag aag gca gag gga gtg gcg ctg acc aat gcc act ggg gcg gta gag E K Q P K K A E G V A L T N A T G A V E tcc aca tcc cag gct ggg gac cgc ggc agt gtt agc agc tac gac aga ggc cag ccc tac S T S Q A G D R G S V S S Y D R G Q P Y gcc acc gag tgg tca gac gac gag agt ggg aac ccc ttt ggg ggc agt gag acc aac ggg A T E W S D D E S G N P F G G S E T N G ggc gcc aac ccc ttt gag gac gac tcc aag gga gtg cgc gtg cgg gca ctc tac gac tat G A N P F E D D S K G V R V R A L Y D Y gac ggc cag gag cag gac gag ctc agc ttt aag gcc gga gac gaa ctc acc aag ctg ggc D G Q E Q D E L S F K A G D E L T K L G gag gag gat gag cag ggc tgg tgc cgt ggg cgg ctg gac agc ggg cag ctg ggc ctc tac E E D E Q G W C R G R L D S G Q L G L Y cct gcc aac tac gtg gag gct atc tag aac cca gct P A N Y V E A I - N P A PACSIN3+2-nV5 atg gca ggc aag cca atc cct aac cct ctg ctg ggc ctg gac agc acc gaa ttg atc aca M A G K P I P N P L L G L D S T E L I T agt ttg tac aaa aaa gca ggc tcc acc gta gaa gtg tcc agc gac agc ttc tgg gag gtc S L Y K K A G S T V E V S S D S F W E V ggg aac tac aag cgg act gtg aag cgg atc gac gat ggc cac cgc ctg tgc agc gac ctc G N Y K R T V K R I D D G H R L C S D L atg aac tgc ctg cat gag cgg gcg cgc atc gag aag gcg tat gcg cag cag ctc act gag M N C L H E R A R I E K A Y A Q Q L T E tgg gcc cgg cgc tgg agg cag ctc gtg gag aaa ggg ccc cag tac ggg acc gtg gag aag W A R R W R Q L V E K G P Q Y G T V E K gcc tgg atg gcc ttc atg tcc gag gca gag agg gtg agc gag ctg cac ctc gag gtg aag A W M A F M S E A E R V S E L H L E V K gcc tca ctg atg aac gat gac ttc gag aag atc aag aac tgg cag aag gaa gcc ttt cac A S L M N D D F E K I K N W Q K E A F H 221 Chapter 6. Appendix aag cag atg atg ggc ggc ttc aag gag acc aag gaa gct gag gac ggc ttt cgg aag gca K Q M M G G F K E T K E A E D G F R K A cag aag ccc tgg gcc aag aag ctg aaa gag gta gaa gca gca aag aaa gcc cac cat gca Q K P W A K K L K E V E A A K K A H H A gcg tgc aaa gag gag aag ctg gct atc tca cga gaa gcc aac agc aag gca gac cca tcc A C K E E K L A I S R E A N S K A D P S ctc aac cct gaa cag ctc aag aaa ttg caa gac aaa ata gaa aag tgc aag caa gat gtt L N P E Q L K K L Q D K I E K C K Q D V ctt aag acc aaa gag aag tat gag aag tcc ctg aaa gaa ctc gac cag ggc aca ccc cag L K T K E K Y E K S L K E L D Q G T P Q tac atg gag aac atg gag cag tgt ttg agc agt gcc agc agt tcg agg aga aaa cgc ctt Y M E N M E Q C L S S A S S S R R K R L cgc ttc ttc cgg gag gtt ctg ctg gag gtt cag aag cac cta gac ctg tcc aat gtg gct R F F R E V L L E V Q K H L D L S N V A ggc tac aaa gcc att tac cat gac ctg gag cag agc atc aga gca gct gat gca gtg gag G Y K A I Y H D L E Q S I R A A D A V E gac ctg cgc tgg tgg cgc agc acc cac ggg cca ggc atg gcc atg aac tgg cca cag ttc D L R W W R S T H G P G M A M N W P Q F gag gag tgg tcc ttg gac aca cag agg aca atc agc cgg aaa gag aag ggt ggc cgg agc E E W S L D T Q R T I S R K E K G G R S cct gat gag gtt acc ctg acc agc att gtg cct aca aga gat ggc acc gca ccc cca ccc P D E V T L T S I V P T R D G T A P P P cag tcc ccg ggg tcc cca ggc acg ggg cag gat gag gag tgg tca gat gaa gag agt ccc Q S P G S P G T G Q D E E W S D E E S P cgg aag gct gcc acc ggg gtt cgg gtg agg gca ctc tat gac tac gct ggc cag gaa gct R K A A T G V R V R A L Y D Y A G Q E A gat gag ctg agc ttc cga gca ggg gag gag ctg ctg aag atg agt gag gag gac gag cag D E L S F R A G E E L L K M S E E D E Q ggc tgg tgc caa ggc cag ttg cag agt ggc cgc att ggc ctg tac cct gcc aac tac gtg G W C Q G Q L Q S G R I G L Y P A N Y V gag tgt gtg ggc gcc tag E C V G A - hsTRPML1-cGFP atgaccgcgccggcgggcccgcgcggcagcgaaaccgaacgcctgctgaccccgaacccgggctatggcacccaggcgggcccgagcccggcgccgccg M T A P A G P R G S E T E R L L T P N P G Y G T Q A G P S P A P P accccgccggaagaagaagatctgcgccgccgcctgaaatatttttttatgagcccgtgcgataaatttcgcgcgaaaggccgcaaaccgtgcaaactg T P P E E E D L R R R L K Y F F M S P C D K F R A K G R K P C K L atgctgcaggtggtgaaaattctggtggtgaccgtgcagctgattctgtttggcctgagcaaccagctggcggtgacctttcgcgaagaaaacaccatt M L Q V V K I L V V T V Q L I L F G L S N Q L A V T F R E E N T I gcgtttcgccatctgtttctgctgggctatagcgatggcgcggatgatacctttgcggcgtatacccgcgaacagctgtatcaggcgatttttcatgcg A F R H L F L L G Y S D G A D D T F A A Y T R E Q L Y Q A I F H A gtggatcagtatctggcgctgccggatgtgagcctgggccgctatgcgtatgtgcgcggcggcggcgatccgtggaccaacggcagcggcctggcgctg V D Q Y L A L P D V S L G R Y A Y V R G G G D P W T N G S G L A L tgccagcgctattatcatcgcggccatgtggatccggcgaacgatacctttgatattgatccgatggtggtgaccgattgcattcaggtggatccgccg C Q R Y Y H R G H V D P A N D T F D I D P M V V T D C I Q V D P P 222 Chapter 6. Appendix gaacgcccgccgccgccgccgagcgatgatctgaccctgctggaaagcagcagcagctataaaaacctgaccctgaaatttcataaactggtgaacgtg E R P P P P P S D D L T L L E S S S S Y K N L T L K F H K L V N V accattcattttcgcctgaaaaccattaacctgcagagcctgattaacaacgaaattccggattgctatacctttagcgtgctgattacctttgataac T I H F R L K T I N L Q S L I N N E I P D C Y T F S V L I T F D N aaagcgcatagcggccgcattccgattagcctggaaacccaggcgcatattcaggaatgcaaacatccgagcgtgtttcagcatggcgataacagcttt K A H S G R I P I S L E T Q A H I Q E C K H P S V F Q H G D N S F cgcctgctgtttgatgtggtggtgattctgacctgcagcctgagctttctgctgtgcgcgcgcagcctgctgcgcggctttctgctgcagaacgaattt R L L F D V V V I L T C S L S F L L C A R S L L R G F L L Q N E F gtgggctttatgtggcgccagcgcggccgcgtgattagcctgtgggaacgcctggaatttgtgaacggctggtatattctgctggtgaccagcgatgtg V G F M W R Q R G R V I S L W E R L E F V N G W Y I L L V T S D V ctgaccattagcggcaccattatgaaaattggcattgaagcgaaaaacctggcgagctatgatgtgtgcagcattctgctgggcaccagcaccctgctg L T I S G T I M K I G I E A K N L A S Y D V C S I L L G T S T L L gtgtgggtgggcgtgattcgctatctgaccttttttcataactataacattctgattgcgaccctgcgcgtggcgctgccgagcgtgatgcgcttttgc V W V G V I R Y L T F F H N Y N I L I A T L R V A L P S V M R F C tgctgcgtggcggtgatttatctgggctattgcttttgcggctggattgtgctgggcccgtatcatgtgaaatttcgcagcctgagcatggtgagcgaa C C V A V I Y L G Y C F C G W I V L G P Y H V K F R S L S M V S E tgcctgtttagcctgattaacggcgatgatatgtttgtgacctttgcggcgatgcaggcgcagcagggccgcagcagcctggtgtggctgtttagccag C L F S L I N G D D M F V T F A A M Q A Q Q G R S S L V W L F S Q ctgtatctgtatagctttattagcctgtttatttatatggtgctgagcctgtttattgcgctgattaccggcgcgtatgataccattaaacatccgggc L Y L Y S F I S L F I Y M V L S L F I A L I T G A Y D T I K H P G ggcgcgggcgcggaagaaagcgaactgcaggcgtatattgcgcagtgccaggatagcccgaccagcggcaaatttcgccgcggcagcggcagcgcgtgc G A G A E E S E L Q A Y I A Q C Q D S P T S G K F R R G S G S A C agcctgctgtgctgctgcggccgcgatccgagcgaagaacatagcctgctggtgaacatgagcaaaggcgaagaactgtttaccggcgtggtgccgatt S L L C C C G R D P S E E H S L L V N M S K G E E L F T G V V P I ctggtggaactggatggcgatgtgaacggccataaatttagcgtgagcggcgaaggcgaaggcgatgcgacctatggcaaactgaccctgaaatttatt L V E L D G D V N G H K F S V S G E G E G D A T Y G K L T L K F I tgcaccaccggcaaactgccggtgccgtggccgaccctggtgaccacctttagctatggcgtgcagtgctttagccgctatccggatcatatgaaacag C T T G K L P V P W P T L V T T F S Y G V Q C F S R Y P D H M K Q catgatttttttaaaagcgcgatgccggaaggctatgtgcaggaacgcaccattttttttaaagatgatggcaactataaaacccgcgcggaagtgaaa H D F F K S A M P E G Y V Q E R T I F F K D D G N Y K T R A E V K tttgaaggcgataccctggtgaaccgcattgaactgaaaggcattgattttaaagaagatggcaacattctgggccataaactggaatataactataac F E G D T L V N R I E L K G I D F K E D G N I L G H K L E Y N Y N agccataacgtgtatattatggcggataaacagaaaaacggcattaaagtgaactttaaaattcgccataacattgaagatggcagcgtgcagctggcg S H N V Y I M A D K Q K N G I K V N F K I R H N I E D G S V Q L A gatcattatcagcagaacaccccgattggcgatggcccggtgctgctgccggataaccattatctgagcacccagagcgcgctgagcaaagatccgaac D H Y Q Q N T P I G D G P V L L P D N H Y L S T Q S A L S K D P N gaaaaacgcgatcatatggtgctgctggaatttgtgaccgcggcgggcattacccatggcatggatgaactgtataaatag E K R D H M V L L E F V T A A G I T H G M D E L Y K - YAP1_WW1 domain-His6 cat atg agc agc ttt gag atc ccg gac gac gtg ccg ctg ccg gcg ggt tgg gag atg gcg H M S S F E I P D D V P L P A G W E M A aag acc agc agc ggt cag cgt tac ttt ctg aac cac atc gac cag acc acc acc tgg caa K T S S G Q R Y F L N H I D Q T T T W Q gat ccg cgt aag gcg atg gag aat ctg tat ttt caa ggt cat cat cat cat cat cat taa D P R K A M E N L Y F Q G H H H H H H - 223 Chapter 6. Appendix gga tcc G S YAP1_WW2 domain-His6 cat atg agc gcg agc ggt ccg ctg ccg gat ggt tgg gag cag gcg atg acc caa gat ggt H M S A S G P L P D G W E Q A M T Q D G gaa atc tac tac atc aac cac aag aac aag acc acc agc tgg ctg gac ccg cgt ctg gac E I Y Y I N H K N K T T S W L D P R L D ccg cgt gag aat ctg tat ttt caa ggt cat cat cat cat cat cat taa P R E N L Y F Q G H H H H H H - hsYAP1_WW1+WW2 domains-His6 cat atg agc agc ttt gag atc ccg gac gac gtg ccg ctg ccg gcg ggt tgg gag atg gcg H M S S F E I P D D V P L P A G W E M A aag acc agc agc ggt cag cgt tac ttt ctg aac cac atc gac cag acc acc acc tgg caa K T S S G Q R Y F L N H I D Q T T T W Q gat ccg cgt aag gcg atg ctg agc cag atg aac gtg acc gcg ccg acc agc ccg ccg gtt D P R K A M L S Q M N V T A P T S P P V cag caa aac atg atg aac agc gcg agc ggt ccg ctg ccg gat ggt tgg gag cag gcg atg Q Q N M M N S A S G P L P D G W E Q A M acc caa gat ggt gaa atc tac tac atc aac cac aag aac aag acc acc agc tgg ctg gac T Q D G E I Y Y I N H K N K T T S W L D ccg cgt ctg gac ccg cgt gag aat ctg tat ttt caa ggt cat cat cat cat cat cat taa P R L D P R E N L Y F Q G H H H H H H - 224 Chapter 7. List of Figures 7 List of Figures 1.1 Multiple alignment phylogenetic tree of the mammalian TRP channel superfamily. . . . . . . . . . . . . . 17 1.2 Structures of human TRP channels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 1.3 TRP channel PPI network extracted from the TRIP Database. . . . . . . . . . . . . . . . . . . . . 20 1.4 Distribution of TRPV4 channelopathy mutations . . . . . . . . . . . . . . . . . . . . . . . . . . 22 4.1 Purification of in vivo biotinylated and structural intact TRPV4 N-terminal constructs . . . . . . . . . . . . 85 4.2 Outline of the proteomics workflow performed in this work . . . . . . . . . . . . . . . . . . . . . . 88 4.3 UDMSE measurements revealed up to 64 probable hsV4N protein interactors. . . . . . . . . . . . . . . 89 4.4 Interaction map and GO Enrichment Components and Processes of hsV4N interactome proteins detected via UDMSE 90 4.5 Interaction map and GO Enrichment Components and Processes of hsV4N interactome proteins detected via UDMSE with Ca2+ sample supplementation . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 4.7 Overlap of proteins detected in respective detected in respective UDMSE experiments without (A) and with Ca2+ sample supplementation (B) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 4.6 Interaction map and GO Enrichment Components and Processes of hsV4 ARD wt Avi, hsV4 ARD R232C Avi and hsV4 ARD K276E Avi interactome proteins detected via UDMSE without and with Ca2+ sample supplementation 95 4.8 Purification of recombinant TRPV4 N-terminal constructs and human DDX3X . . . . . . . . . . . . . . 100 4.9 hsV4 ARD, but not hsV4N, decreases the DDX3X ATPase activity . . . . . . . . . . . . . . . . . . . 102 4.10 XL-MS confirms a direct interaction between hsV4N and DDX3X . . . . . . . . . . . . . . . . . . . 103 4.11 hsV4 ARD interacts with dxRNA-bound DDX3X . . . . . . . . . . . . . . . . . . . . . . . . . . 104 4.12 dsRNA binding changes the tryptophan environment in DDX3X dramatically. . . . . . . . . . . . . . . . 106 4.13 Inhibition of DDX3X ATPase activity is enhanced in the presence of neuropathy-causing TRPV4 R232C mutation. 107 4.14 Co-Immunoprecipitations of various full-length human TRPV4-GFP constructs and DDX3X-V5 in HEK293 cells show an increased DDX3X-V5 pulldown with the neuropathy-causing TRPV4-R232C mutation . . . . . . . . . . 108 4.15 Immunofluorescence images of HEK293T cells co-transfected with TRPV4-GFP (green) and DDX3X-V5 (magenta) reveal an cytosolic DDX3X densificaton, especially in the presence of TRPV4-R232C-GFP. . . . . . . . . . 109 4.16 Human PACSIN1 and 3, but not PACSIN2, dampen human TRPV4-mediated Ca2+-influx in transiently transfected HEK293T cells upon hypotonicity . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 113 4.17 Human PACSIN1 does not dampen human TRPV4-mediated Ca2+-influx in HEK293T cells transiently transfected with TRPV4 R269C upon hypotonicity. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 115 4.18 PACSIN chimeras hint towards regulation modes between PACSIN1 and PACSIN3 on TRPV4-mediated Ca-influx in tar HEK293T cells . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 4.19 Purification of hsV4 ARD wt and 15N-RhoA 15N-RhoA . . . . . . . . . . . . . . . . . . . . . . . 120 4.20 NMR experiments revealed an decreased PPI between 15N-RhoA and the neuropathy-causing mutation R269C in hsV4 ARD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 122 4.21 Relative signal intensity changes of RhoA in the presence of unlabeled hsV4 ARD wt and R269C, respectively. . 123 4.22 Interaction sites of hsV4 ARD with 15N-RhoA . . . . . . . . . . . . . . . . . . . . . . . . . . . . 124 4.23 Purification of recombinant TRPV4 N-terminal constructs and human ITCH . . . . . . . . . . . . . . . 126 4.24 ITCH and hsV4N are direct interaction partners . . . . . . . . . . . . . . . . . . . . . . . . . . 129 4.25 In vitro ubiquitination assay shows ubiquitination of hsV4N by ITCH . . . . . . . . . . . . . . . . . . 130 225 Chapter 7. List of Figures 4.26 Cross-link mass spectrometry (XL-MS) measurements showing inter- and/or intramolecular interactions between ITCH molecules . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 131 4.27 Fluorescence microscopy images reveal stress fiber formation upon TRPV4 activation in stably transfected HEK293 cells. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 134 4.28 ELSEXY GFP TRITC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 135 5.1 Tissue specificity of neuropathy-causing TRPV4 mutations occur due to aberrant tissue specific protein-protein in- teractions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 141 6.1 TRP channel PPI network extracted from the TRIP Database. . . . . . . . . . . . . . . . . . . . . 143 6.2 Purification of unbiotinylated hsV4 ARD Avi constructs . . . . . . . . . . . . . . . . . . . . . . . 152 6.3 hsV4 ARD does not influence or inhibit the assay components lactate dehydrogenase and pyruvate kinase . . 177 6.4 Overlay of spectra of 1H-15N RhoA 2D HSCQs of 15N-RhoA on its own and with hsV4 ARD wt . . . . . . . 183 6.5 Overlay of spectra of 1H-15N RhoA 2D HSCQs of 15N-RhoA on its own and with hsV4 R269C . . . . . . . 184 6.6 Annotated samples in BN PAGE, submitted to MS measurements . . . . . . . . . . . . . . . . . . . 189 6.7 Fluorescence microscopy images show no effect of GSK-101 or HC-067 on the cytoskeleton of unstransfected HEK293 cells . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 192 6.8 Pearson Correlation Coefficients (PCC, r) of respective fluorescence marker pair. . . . . . . . . . . . . . 193 6.9 M-values . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 194 6.10 Fluorescence microscopy images of HEK293 cells stabily transfected with hsTRPV4-cGFP . . . . . . . . . 201 6.11 Stably transfected HEK293 cells express funtional hsTRPV4-cGFP. . . . . . . . . . . . . . . . . . . 201 6.12 Fluorescence microscopy images of HEK293 cells stabily transfected with hsTRPML1-cGFP . . . . . . . . 202 6.13 Purification of recombinant human ITCH WW domains . . . . . . . . . . . . . . . . . . . . . . . 202 6.14 Purification of recombinant human YAP1 WW domains . . . . . . . . . . . . . . . . . . . . . . . 203 226 Chapter 8. List of Tables 8 List of Tables 2.1 Chemicals . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 2.2 General buffer and solutions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31 2.3 Buffer and solutions for purification of hsV4N, hsV4N∆122 and hsV4N∆132 constructs. hsV4N∆132 is also re- ferred to as hsV4 ARD, hsV4N∆122 as hsV4 ARD-PRR. . . . . . . . . . . . . . . . . . . . . . . 34 2.4 Buffer and solutions for purification of hsRhoA . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 2.5 Buffer and solutions for purification of hsDDX3X_aa122-582 (DDX3X) . . . . . . . . . . . . . . . . . 36 2.6 Buffer and solutions for purification of hsITCH . . . . . . . . . . . . . . . . . . . . . . . . . . . 37 2.7 Buffer and solutions for purification of hsITCH WW domain constructs . . . . . . . . . . . . . . . . . 38 2.8 Buffer and solutions for purification of TRPC 3, 4 and 6 ARDs . . . . . . . . . . . . . . . . . . . . 39 2.9 Buffer and solutions for purification of hsYAP-WW domains . . . . . . . . . . . . . . . . . . . . . 40 2.10 Enzymes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41 2.11 Antibodies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 42 2.12 Oligonucleotides for Quickchange PCR . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 43 2.12 Oligonucleotides for Quickchange PCR . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 2.13 Oligonucleotides for Gibbson Assembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 2.13 Oligonucleotides for Gibbson Assembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 45 2.14 Sequencing oligonucleotides . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 45 2.15 Expression plasmids generated and used in the course of this work. hsV4N∆132 is also referred as hsV4 ARD, hsV4N∆122 as hsV4 ARD-PRR. The nomenclature of the plasmids refers to the employed nomenclature at the Hellmich workgroup. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 2.15 Expression plasmids generated and used in the course of this work. hsV4N∆132 is also referred as hsV4 ARD, hsV4N∆122 as hsV4 ARD-PRR. The nomenclature of the plasmids refers to the employed nomenclature at the Hellmich workgroup. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 48 2.15 Expression plasmids generated and used in the course of this work. hsV4N∆132 is also referred as hsV4 ARD, hsV4N∆122 as hsV4 ARD-PRR. The nomenclature of the plasmids refers to the employed nomenclature at the Hellmich workgroup. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 2.15 Expression plasmids generated and used in the course of this work. hsV4N∆132 is also referred as hsV4 ARD, hsV4N∆122 as hsV4 ARD-PRR. The nomenclature of the plasmids refers to the employed nomenclature at the Hellmich workgroup. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 50 2.15 Expression plasmids generated and used in the course of this work. hsV4N∆132 is also referred as hsV4 ARD, hsV4N∆122 as hsV4 ARD-PRR. The nomenclature of the plasmids refers to the employed nomenclature at the Hellmich workgroup. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 2.16 Characteristics of proteins and peptides used in this thesis. . . . . . . . . . . . . . . . . . . . . . 52 2.17 Characteristics of proteins and peptides used in this thesis. . . . . . . . . . . . . . . . . . . . . . 53 2.18 Kits . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54 2.19 Media and supplements for cell culture . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 2.20 Cells . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 2.20 Cells . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56 2.21 Laboratory equipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56 227 Chapter 8. List of Tables 2.22 Software . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 3.1 DpnI digestion reaction mixture . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 3.2 Reaction mixtures for Gibson Assembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 3.3 Composition of the stacking and separation gel for SDS-PAGE . . . . . . . . . . . . . . . . . . . . 61 3.3 Composition of the stacking and separation gel for SDS-PAGE . . . . . . . . . . . . . . . . . . . . 62 3.4 Used primary antibody solutions and blocking solutions . . . . . . . . . . . . . . . . . . . . . . . 62 3.5 Used secondary antibody solutions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63 3.6 Used SEC columns, manufactured by GE Healthcare . . . . . . . . . . . . . . . . . . . . . . . . 64 3.7 Used plasmid DNA amounts for transfections of HEK293T cells with Lipofectamine ®LTX . . . . . . . . . 65 3.8 Used plasmid amounts for stable transfections of HEK293 cells with Lipofectamine ®LTX . . . . . . . . . 67 3.9 Antibodies used for cell immunostainings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 3.10 Expression conditions of human N-terminal TRPV4 (hsV4N) constructs . . . . . . . . . . . . . . . . . 70 3.11 Expression conditions of human RhoA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 3.12 Expression conditions of hsDDX3X . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 3.13 Expression conditions of human ITCH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 3.14 Expression conditions of human ITCH WW domains . . . . . . . . . . . . . . . . . . . . . . . . 75 3.15 Expression conditions of human YAP WW domains . . . . . . . . . . . . . . . . . . . . . . . . . 76 3.16 Sample composition for the in vitro-ATPase assay . . . . . . . . . . . . . . . . . . . . . . . . . 80 3.17 Sample composition for the in vitro-Ubiquitinylation assay . . . . . . . . . . . . . . . . . . . . . . 81 4.1 Sample overview of hsV4N interactome pulldowns with HEK293 cytosolic protein extracts . . . . . . . . . 87 6.1 List of human TRP channel protein interactors deposited in the TRIP database . . . . . . . . . . . . . . 144 6.2 List of known TRPV4 interactors deposited in the TRIP database . . . . . . . . . . . . . . . . . . . 146 6.3 List of cytoplasmic RNP granule and stress granule proteins found in the hsV4N protein interactome via UDMSE in this work . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 153 6.4 List of cytoplasmic RNP granule and stress granule proteins found in the hsV4N protein interactome in the presence of 2 mM Ca2+ via UDMSE in this work . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 155 6.5 List of cytoplasmic RNP granule and stress granule proteins found in the hsV4 ARD wt protein interactome deter- mined via UDMSE in this work . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 158 6.6 List of cytoplasmic RNP granule and stress granule proteins found in the hsV4 ARD wt protein interactome in the presence of 2 mM Ca2+ determined via UDMSE in this work . . . . . . . . . . . . . . . . . . . . . 160 6.7 List of cytoplasmic RNP granule and stress granule proteins found in the hsV4 ARD R232C protein interactome determined via UDMSE in this work . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 165 6.8 List of cytoplasmic RNP granule and stress granule proteins found in the hsV4 ARD R232C protein interactome in the presence of 2 mM Ca2+ determined via UDMSE in this work . . . . . . . . . . . . . . . . . . . . 166 6.9 List of cytoplasmic RNP granule and stress granule proteins found in the hsV4 ARD K276E protein interactome determined via UDMSE in this work . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 168 6.10 List of cytoplasmic RNP granule and stress granule proteins found in the hsV4 ARD K276E protein interactome in the presence of 2 mM Ca2+ determined via UDMSE in this work . . . . . . . . . . . . . . . . . . . . 173 6.11 MS data of ubiquitinated hsV4N after in vitro ubiquitination assay with ITCH . . . . . . . . . . . . . . . 185 6.12 MS data of BN PAGE complexes of ITCH and hsV4N . . . . . . . . . . . . . . . . . . . . . . . . 190 6.14 P and M-values of GFP (TRPV4-cGFP) and TRITC (F-actin stained with Phalloidon TRITC) images of stably trans- fected HEK293 cells upon various treatments, determined and calculated by ELSEXY (see also figures 4.28, 6.9 and 6.8). PCC = Pearson correlation coefficient r . . . . . . . . . . . . . . . . . . . . . . . . . 194 6.15 P and M-values of TRITC (F-actin stained with Phalloidon TRITC) and DAPI (Nucleus) images of stably transfected HEK293 cells upon various treatments, determined and calculated by ELSEXY (see also figures 4.28, 6.9 and 6.8). PCC = Pearson correlation coefficient r . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 196 228 Chapter 8. List of Tables 6.16 P and M-values of GFP (TRPV4-cGFP) and DAPI (Nucleus) images of stably transfected HEK293 cells upon various treatments, determined and calculated by ELSEXY (see also figures 4.28, 6.9 and 6.8). PCC = Pearson correlation coefficient r . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 198 229 9 Bibliography 9 Bibliography 1. Cosens, D. J. & Manning, A. Abnormal Electroretinogram from a Drosophila Mutant. Nature 224, 285–287 (1969). 2. Thompson, J. D., Higgins, D. G. & Gibson, T. J. CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice. Nucleic Acids Research 22, 4673–4680 (1994). 3. Dereeper, A. et al. Phylogeny.fr: robust phylogenetic analysis for the non-specialist. Nu- cleic Acids Research 36, W465–W469 (2008). 4. Dereeper, A., Audic, S., Claverie, J.-M. & Blanc, G. BLAST-EXPLORER helps you build- ing datasets for phylogenetic analysis. BMC Evolutionary Biology 10, 8 (2010). 5. Hardie, R. C. & Minke, B. The trp gene is essential for a light-activated Ca2+ channel in Drosophila photoreceptors. Neuron 8, 643–651 (1992). 6. Nilius, B. & Flockerzi, V. Mammalian transient receptor potential (TRP) cation channels (Springer, New York, 2014). 7. Clapham, D. E. TRP channels as cellular sensors. Nature 426, 517–524 (2003). 8. Huber, A. et al. The transient receptor potential protein (Trp), a putative store-operated Ca2+ channel essential for phosphoinositide-mediated photoreception, forms a signaling complex with NorpA, InaC and InaD. The EMBO journal 15, 7036–7045 (1996). 9. Giniatullin, R. Ion Channels of Nociception. International Journal of Molecular Sciences 21, 3553 (2020). 10. Mickle, A., Shepherd, A. & Mohapatra, D. Nociceptive TRP Channels: Sensory Detectors and Transducers in Multiple Pain Pathologies. Pharmaceuticals 9, 72 (2016). 11. Cui, M., Gosu, V., Basith, S., Hong, S. & Choi, S. in Advances in Protein Chemistry and Structural Biology 81–125 (Elsevier, 2016). 12. Ramsey, I. S., Delling, M. & Clapham, D. E. An introduction to TRP channels. Annual Review of Physiology 68, 619–647 (2006). 230 9 Bibliography 13. Hoffstaetter, L. J., Bagriantsev, S. N. & Gracheva, E. O. TRPs et al.: a molecular toolkit for thermosensory adaptations. Pflügers Archiv - European Journal of Physiology (2018). 14. Nilius, B., Owsianik, G., Voets, T. & Peters, J. A. Transient Receptor Potential Cation Channels in Disease. Physiological Reviews 87, 165–217 (2007). 15. Nilius, B. TRP channels in disease. Biochimica Et Biophysica Acta 1772, 805–812 (2007). 16. Chun, J. N. et al. A network perspective on unraveling the role of TRP channels in biology and disease. Pflugers Archiv: European Journal of Physiology 466, 173–182 (2014). 17. Echeverry, S., Rodriguez, M. J. & Torres, Y. P. Transient Receptor Potential Channels in Microglia: Roles in Physiology and Disease. Neurotoxicity Research 30, 467–478 (2016). 18. Botte, M. et al. Cryo-EM structural studies of the agonist complexed human TRPV4 ion-channel reveals novel structural rearrangements resulting in an open-conformation. preprint (Molecular Biology, 2020). 19. Pumroy, R. A., Fluck, E. C., Ahmed, T. & Moiseenkova-Bell, V. Y. Structural insights into the gating mechanisms of TRPV channels. Cell Calcium 87, 102168 (2020). 20. Cao, E. Structural mechanisms of transient receptor potential ion channels. Journal of General Physiology 152, e201811998 (2020). 21. Goretzki, B. Towards an understanding of the regulation of TRPV4 by PIP2 and PAC- SIN3. Master thesis. Johhanes Gutenberg-University Mainz (2016). 22. Goretzki, B. et al. Structural Basis of TRPV4 N Terminus Interaction with Syndapin/PACSIN1- 3 and PIP2. Structure 26, 1583–1593.e5 (2018). 23. Goretzki, B. Interactions of the ion channel TRPV4 with regulatory lipids and proteins. PhD thesis (Johannes-Gutenberg University, Mainz, 2020). 24. Hellmich, U. A. & Gaudet, R. in Mammalian Transient Receptor Potential (TRP) Cation Channels (eds Nilius, B. & Flockerzi, V.) 963–990 (Springer International Publishing, Cham, 2014). 25. Liao, M., Cao, E., Julius, D. & Cheng, Y. Structure of the TRPV1 ion channel determined by electron cryo-microscopy. Nature 504, 107–112 (2013). 26. Li, J., Mahajan, A. & Tsai, M.-D. Ankyrin Repeat: A Unique Motif Mediating Protein−Protein Interactions. Biochemistry 45, 15168–15178 (2006). 231 9 Bibliography 27. Inada, H., Procko, E., Sotomayor, M. & Gaudet, R. Structural and Biochemical Conse- quences of Disease-Causing Mutations in the Ankyrin Repeat Domain of the Human TRPV4 Channel. Biochemistry 51, 6195–6206 (2012). 28. Gorina, S. & Pavletich, N. P. Structure of the p53 tumor suppressor bound to the ankyrin and SH3 domains of 53BP2. Science (New York, N.Y.) 274, 1001–1005 (1996). 29. Shin, Y.-C., Shin, S.-Y., So, I., Kwon, D. & Jeon, J.-H. TRIP Database: a manually curated database of protein-protein interactions for mammalian TRP channels. Nucleic Acids Research 39, D356–361 (Database issue 2011). 30. Shin, Y.-C. et al. TRIP database 2.0: a manually curated information hub for accessing TRP channel interaction network. PloS One 7, e47165 (2012). 31. Nilius, B. & Voets, T. The puzzle of TRPV4 channelopathies. EMBO reports 14, 152–163 (2013). 32. Liedtke, W. et al. Vanilloid Receptor–Related Osmotically Activated Channel (VR-OAC), a Candidate Vertebrate Osmoreceptor. Cell 103, 525–535 (2000). 33. Liedtke, W. & Friedman, J. M. Abnormal osmotic regulation in trpv4-/- mice. Proceedings of the National Academy of Sciences of the United States of America 100, 13698–13703 (2003). 34. Mizuno, A., Matsumoto, N., Imai, M. & Suzuki, M. Impaired osmotic sensation in mice lacking TRPV4. American Journal of Physiology. Cell Physiology 285, C96–101 (2003). 35. Watanabe, H. et al. Activation of TRPV4 Channels (hVRL-2/mTRP12) by Phorbol Deriva- tives. Journal of Biological Chemistry 277, 13569–13577 (2002). 36. Watanabe, H. et al. Anandamide and arachidonic acid use epoxyeicosatrienoic acids to activate TRPV4 channels. Nature 424, 434–438 (2003). 37. Watanabe, H. et al. Heat-evoked activation of TRPV4 channels in a HEK293 cell ex- pression system and in native mouse aorta endothelial cells. The Journal of Biological Chemistry 277, 47044–47051 (2002). 38. Gueler, A. D. et al. Heat-evoked activation of the ion channel, TRPV4. The Journal of Neuroscience: The Official Journal of the Society for Neuroscience 22, 6408–6414 (2002). 39. Garcia-Elias, A. et al. Phosphatidylinositol-4,5-biphosphate-dependent rearrangement of TRPV4 cytosolic tails enables channel activation by physiological stimuli. Proceedings of the National Academy of Sciences 110, 9553–9558 (2013). 232 9 Bibliography 40. Masuyama, R. et al. TRPV4-mediated calcium influx regulates terminal differentiation of osteoclasts. Cell Metabolism 8, 257–265 (2008). 41. Masuyama, R. et al. Calcium/calmodulin-signaling supports TRPV4 activation in osteo- clasts and regulates bone mass. Journal of Bone and Mineral Research 27, 1708–1721 (2012). 42. Marrelli, S. P., O’neil, R. G., Brown, R. C. & Bryan, R. M. PLA2 and TRPV4 channels regulate endothelial calcium in cerebral arteries. American Journal of Physiology. Heart and Circulatory Physiology 292, H1390–1397 (2007). 43. Sonkusare, S. K. et al. Elementary Ca2+ signals through endothelial TRPV4 channels regulate vascular function. Science (New York, N.Y.) 336, 597–601 (2012). 44. Saliez, J. et al. Role of caveolar compartmentation in endothelium-derived hyperpolariz- ing factor-mediated relaxation: Ca2+ signals and gap junction function are regulated by caveolin in endothelial cells. Circulation 117, 1065–1074 (2008). 45. Tabuchi, K., Suzuki, M., Mizuno, A. & Hara, A. Hearing impairment in TRPV4 knockout mice. Neuroscience Letters 382, 304–308 (2005). 46. Everaerts, W., Nilius, B. & Owsianik, G. The vanilloid transient receptor potential channel TRPV4: From structure to disease. Progress in Biophysics and Molecular Biology 103, 2–17 (2010). 47. Lamandé, S. R. et al. Mutations in TRPV4 cause an inherited arthropathy of hands and feet. Nature Genetics 43, 1142–1146 (2011). 48. Unger, S. et al. Fetal akinesia in metatropic dysplasia: The combined phenotype of chon- drodysplasia and neuropathy? American Journal of Medical Genetics Part A 155, 2860– 2864 (2011). 49. Camacho, N. et al. Dominant TRPV4 mutations in nonlethal and lethal metatropic dys- plasia. American Journal of Medical Genetics Part A 152A, 1169–1177 (2010). 50. Rock, M. J. et al. Gain-of-function mutations in TRPV4 cause autosomal dominant brachy- olmia. Nature Genetics 40, 999–1003 (2008). 51. Krakow, D. et al. Mutations in the Gene Encoding the Calcium-Permeable Ion Channel TRPV4 Produce Spondylometaphyseal Dysplasia, Kozlowski Type and Metatropic Dys- plasia. The American Journal of Human Genetics 84, 307–315 (2009). 233 9 Bibliography 52. Loukin, S., Su, Z. & Kung, C. Increased Basal Activity Is a Key Determinant in the Severity of Human Skeletal Dysplasia Caused by TRPV4 Mutations. PLoS ONE 6 (ed Callaerts, P.) e19533 (2011). 53. Woolums, B. M. et al. TRPV4 disrupts mitochondrial transport and causes axonal degen- eration via a CaMKII-dependent elevation of intracellular Ca2+. Nature Communications 11 (2020). 54. Klein, C. J. et al. TRPV4 mutations and cytotoxic hypercalcemia in axonal Charcot-Marie- Tooth neuropathies. Neurology 76, 887–894 (2011). 55. Spinal muscular atrophy: disease mechanisms and therapy (eds Sumner, C. J., Paushkin, S. & Ko, C.-P.) OCLC: ocn952982964 (Elsevier/Academic Press, Amsterdam, 2017). 474 pp. 56. Sullivan, J. M. et al. Novel mutations highlight the key role of the ankyrin repeat domain in TRPV4 -mediated neuropathy. Neurology Genetics 1, e29 (2015). 57. Suzuki, Y. et al. TRPV6 Variants Interfere with Maternal-Fetal Calcium Transport through the Placenta and Cause Transient Neonatal Hyperparathyroidism. The American Journal of Human Genetics 102, 1104–1114 (2018). 58. McGoldrick, L. L. et al. Opening of the human epithelial calcium channel TRPV6. Nature (2017). 59. Singh, A. K., McGoldrick, L. L., Twomey, E. C. & Sobolevsky, A. I. Mechanism of calmod- ulin inactivation of the calcium-selective TRP channel TRPV6. Science Advances 4, eaau6088 (2018). 60. Everaerts, W. et al. Inhibition of the cation channel TRPV4 improves bladder function in mice and rats with cyclophosphamide-induced cystitis. Proceedings of the National Academy of Sciences 107, 19084–19089 (2010). 61. Goyal, N. et al. Clinical Pharmacokinetics, Safety, and Tolerability of a Novel, First-in- Class TRPV4 Ion Channel Inhibitor, GSK2798745, in Healthy and Heart Failure Subjects. American Journal of Cardiovascular Drugs: Drugs, Devices, and Other Interventions 19, 335–342 (2019). 62. Thorneloe, K. S. et al. An orally active TRPV4 channel blocker prevents and resolves pulmonary edema induced by heart failure. Science Translational Medicine 4, 159ra148 (2012). 234 9 Bibliography 63. Distler, U., Kuharev, J., Navarro, P. & Tenzer, S. Label-free quantification in ion mobility- enhanced data-independent acquisition proteomics. Nature Protocols 11, 795–812 (2016). 64. Hein, M. Y., Sharma, K., Cox, J. & Mann, M. in Handbook of Systems Biology 3–25 (Elsevier, 2013). 65. Lee, A., Fakler, B., Kaczmarek, L. K. & Isom, L. L. More Than a Pore: Ion Channel Signaling Complexes. Journal of Neuroscience 34, 15159–15169 (2014). 66. Schulte, U., Müller, C. S. & Fakler, B. Ion channels and their molecular environments – Glimpses and insights from functional proteomics. Seminars in Cell & Developmental Biology 22, 132–144 (2011). 67. Schwenk, J. et al. High-Resolution Proteomics Unravel Architecture and Molecular Di- versity of Native AMPA Receptor Complexes. Neuron 74, 621–633 (2012). 68. Caceres, M. et al. TRPM4 Is a Novel Component of the Adhesome Required for Focal Adhesion Disassembly, Migration and Contractility. PloS One 10, e0130540 (2015). 69. McCray, B. A. et al. Neuropathy-causing TRPV4 mutations disrupt TRPV4-RhoA interac- tions and impair neurite extension. Nature Communications 12, 17 (2021). 70. Cuajungco, M. P. et al. PACSINs bind to the TRPV4 cation channel. PACSIN 3 modulates the subcellular localization of TRPV4. The Journal of Biological Chemistry 281, 18753– 18762 (2006). 71. D’hoedt, D. et al. Stimulus-specific Modulation of the Cation Channel TRPV4 by PACSIN 3. Journal of Biological Chemistry 283, 6272–6280 (2008). 72. Distler, U. et al. Drift time-specific collision energies enable deep-coverage data-independent acquisition proteomics. Nature Methods 11, 167–170 (2014). 73. Distler, U., Kuharev, J. & Tenzer, S. Biomedical applications of ion mobility-enhanced data-independent acquisition-based label-free quantitative proteomics. Expert Review of Proteomics 11, 675–684 (2014). 74. Kuharev, J., Navarro, P., Distler, U., Jahn, O. & Tenzer, S. In-depth evaluation of software tools for data-independent acquisition based label-free quantification. PROTEOMICS 15, 3140–3151 (2015). 75. McCray, B. A., Schindler, A., Hoover-Fong, J. E. & Sumner, C. J. in GeneReviews® (eds Adam, M. P. et al.) (University of Washington, Seattle, Seattle (WA), 1993). 235 9 Bibliography 76. Diehl, E. Investigating the interactome of the TRPV4 N-terminus. PhD thesis (Johannes- Gutenberg University, Mainz, 2017). 77. Schmitt, P. Biochemische Studien an Ankyrin repeat Domänen von TRP Ionenkanälen. PhD thesis (Johannes-Gutenberg University, 2018). 78. Doerr, C. Investigating the Interactome of the Human Ion Channel TRPV4 and Associ- ated Channelopathies. PhD thesis (Johannes-Gutenberg University, Mainz, 2019). 79. Gibson, D. G. et al. Enzymatic assembly of DNA molecules up to several hundred kilo- bases. Nature Methods 6, 343–345 (2009). 80. Gibson, D. G. in Methods in Enzymology 349–361 (Elsevier, 2011). 81. Schindelin, J. et al. Fiji: an open-source platform for biological-image analysis. Nature Methods 9, 676–682 (2012). 82. Kay, B. K., Thai, S. & Volgina, V. V. in High Throughput Protein Expression and Purifica- tion (eds Walker, J. M. & Doyle, S. A.) 185–198 (Humana Press, Totowa, NJ, 2009). 83. Holden, P. & Horton, W. A. Crude subcellular fractionation of cultured mammalian cell lines. BMC Research Notes 2, 243 (2009). 84. Sehgal, P., Olesen, C. & Møller, J. V. in P-Type ATPases (ed Bublitz, M.) Series Title: Methods in Molecular Biology, 105–109 (Springer New York, New York, NY, 2016). 85. Swamy, M., Siegers, G. M., Minguet, S., Wollscheid, B. & Schamel, W. W. A. Blue Na- tive Polyacrylamide Gel Electrophoresis (BN-PAGE) for the Identification and Analysis of Multiprotein Complexes. Science Signaling 2006, pl4–pl4 (2006). 86. Sattler, M. Heteronuclear multidimensional NMR experiments for the structure determi- nation of proteins in solution employing pulsed field gradients. Progress in Nuclear Mag- netic Resonance Spectroscopy 34, 93–158 (1999). 87. Fürsch, J., Kammer, K.-M., Kreft, S. G., Beck, M. & Stengel, F. Proteome-Wide Structural Probing of Low-Abundant Protein Interactions by Cross-Linking Mass Spectrometry. An- alytical Chemistry 92, 4016–4022 (2020). 88. Distler, U., Kuharev, J., Navarro, P. & Tenzer, S. Label-free quantification in ion mobility- enhanced data-independent acquisition proteomics. Nature Protocols 11, 795–812 (2016). 89. Landoure, G. et al. Exome sequencing identifies a novel TRPV4 mutation in a CMT2C family. Neurology 79, 192–194 (2012). 236 9 Bibliography 90. Landouré, G. et al. Mutations in TRPV4 cause Charcot-Marie-Tooth disease type 2C. Nature Genetics 42, 170–174 (2010). 91. Kay, B. K., Thai, S. & Volgina, V. V. in High Throughput Protein Expression and Purifica- tion (ed Doyle, S. A.)red. by Walker, J. M., 185–198 (Humana Press, Totowa, NJ, 2009). 92. Nishimura, G. et al. TRPV4-associated skeletal dysplasias. American Journal of Medical Genetics Part C: Seminars in Medical Genetics 160C, 190–204 (2012). 93. Wiedemann, C., Bellstedt, P. & Gorlach, M. CAPITO–a web server-based analysis and plotting tool for circular dichroism data. Bioinformatics 29, 1750–1757 (2013). 94. Le Sage, V., Cinti, A. & Mouland, A. J. in Current Protocols in Cell Biology (eds Bonifa- cino, J. S., Dasso, M., Harford, J. B., Lippincott-Schwartz, J. & Yamada, K. M.) 17.19.1– 17.19.12 (John Wiley & Sons, Inc., Hoboken, NJ, USA, 2016). 95. Bar, D. Z. et al. Biotinylation by antibody recognition—a method for proximity labeling. Nature Methods 15, 127–133 (2017). 96. Cronan, J. E. Biotin and Lipoic Acid: Synthesis, Attachment, and Regulation. EcoSal Plus 1 (2013). 97. Gene Ontology Consortium. The Gene Ontology project in 2008. Nucleic Acids Research 36, D440–444 (Database issue 2008). 98. Szklarczyk, D. et al. STRING v10: protein–protein interaction networks, integrated over the tree of life. Nucleic Acids Research 43, D447–D452 (D1 2015). 99. Gama-Carvalho, M. & Carmo-Fonseca, M. The rules and roles of nucleocytoplasmic shuttling proteins. FEBS Letters 498, 157–163 (2001). 100. Lin, Y., Protter, D. S., Rosen, M. K. & Parker, R. Formation and Maturation of Phase- Separated Liquid Droplets by RNA-Binding Proteins. Molecular Cell 60, 208–219 (2015). 101. Protter, D. S. et al. Intrinsically Disordered Regions Can Contribute Promiscuous Inter- actions to RNP Granule Assembly. Cell Reports 22, 1401–1412 (2018). 102. Kedersha, N. et al. Dynamic Shuttling of Tia-1 Accompanies the Recruitment of mRNA to Mammalian Stress Granules. Journal of Cell Biology 151, 1257–1268 (2000). 103. Kedersha, N. et al. G3BP–Caprin1–USP10 complexes mediate stress granule conden- sation and associate with 40S subunits. Journal of Cell Biology 212 (2016). 104. Kedersha, N., Ivanov, P. & Anderson, P. Stress granules and cell signaling: more than just a passing phase? Trends in Biochemical Sciences 38, 494–506 (2013). 237 9 Bibliography 105. Hofmann, S., Kedersha, N., Anderson, P. & Ivanov, P. Molecular mechanisms of stress granule assembly and disassembly. Biochimica et Biophysica Acta (BBA) - Molecular Cell Research 1868, 118876 (2021). 106. Anderson, P. & Kedersha, N. Stress granules: the Tao of RNA triage. Trends in Biochem- ical Sciences 33, 141–150 (2008). 107. Jain, S. et al. ATPase-Modulated Stress Granules Contain a Diverse Proteome and Sub- structure. Cell 164, 487–498 (2016). 108. Markmiller, S. et al. Context-Dependent and Disease-Specific Diversity in Protein Inter- actions within Stress Granules. Cell 172, 590–604.e13 (2018). 109. Youn, J.-Y. et al. High-Density Proximity Mapping Reveals the Subcellular Organization of mRNA-Associated Granules and Bodies. Molecular Cell 69, 517–532.e11 (2018). 110. Reineke, L. C. & Neilson, J. R. Differences between acute and chronic stress granules, and how these differences may impact function in human disease. Biochemical Pharma- cology 162, 123–131 (2019). 111. Luo, Y., Na, Z. & Slavoff, S. A. P-Bodies: Composition, Properties, and Functions. Bio- chemistry 57, 2424–2431 (2018). 112. Krichevsky, A. M. & Kosik, K. S. Neuronal RNA Granules. Neuron 32, 683–696 (2001). 113. Kimball, S. R., Horetsky, R. L., Ron, D., Jefferson, L. S. & Harding, H. P. Mammalian stress granules represent sites of accumulation of stalled translation initiation complexes. American Journal of Physiology-Cell Physiology 284, C273–C284 (2003). 114. Amen, T. & Kaganovich, D. Stress granules sense metabolic stress at the plasma mem- brane and potentiate recovery by storing active Pkc1. Science Signaling 13, eaaz6339 (2020). 115. Liu-Yesucevitz, L. et al. Local RNA Translation at the Synapse and in Disease. Journal of Neuroscience 31, 16086–16093 (2011). 116. Onishi, H. et al. MBNL1 associates with YB-1 in cytoplasmic stress granules. Journal of Neuroscience Research 86, 1994–2002 (2008). 117. Celia Cui, B. et al. Pharmacological inhibition of DEAD-Box RNA Helicase 3 attenuates stress granule assembly. Biochemical Pharmacology, 114280 (2020). 238 9 Bibliography 118. Shih, J.-W. et al. Critical roles of RNA helicase DDX3 and its interactions with eIF4E/PABP1 in stress granule assembly and stress response. Biochemical Journal 441, 119–129 (2012). 119. Valentin-Vega, Y. A. et al. Cancer-associated DDX3X mutations drive stress granule as- sembly and impair global translation. Scientific Reports 6 (2016). 120. Weidensdorfer, D. et al. Control of c-myc mRNA stability by IGF2BP1-associated cyto- plasmic RNPs. RNA (New York, N.Y.) 15, 104–115 (2009). 121. Fang, M. Y. et al. Modulation of RNA-dependent interactions in stress granules prevents persistent TDP-43 accumulation in ALS/FTD. preprint (Neuroscience, 2018). 122. Fang, M. Y. et al. Small-Molecule Modulation of TDP-43 Recruitment to Stress Gran- ules Prevents Persistent TDP-43 Accumulation in ALS/FTD. Neuron 103, 802–819.e11 (2019). 123. Guillén-Boixet, J. et al. RNA-Induced Conformational Switching and Clustering of G3BP Drive Stress Granule Assembly by Condensation. Cell 181, 346–361.e17 (2020). 124. Henao-Mejia, J. & He, J. J. Sam68 relocalization into stress granules in response to oxidative stress through complexing with TIA-1. Experimental Cell Research 315, 3381– 3395 (2009). 125. Mitsumori, K., Takei, Y. & Hirokawa, N. Components of RNA granules affect their localiza- tion and dynamics in neuronal dendrites. Molecular Biology of the Cell 28 (ed Forscher, P.) 1412–1417 (2017). 126. McDonald, K. K. et al. TAR DNA-binding protein 43 (TDP-43) regulates stress granule dynamics via differential regulation of G3BP and TIA-1. Human Molecular Genetics 20, 1400–1410 (2011). 127. Shih, J.-W. et al. Critical roles of RNA helicase DDX3 and its interactions with eIF4E/PABP1 in stress granule assembly and stress response. Biochemical Journal 441, 119–129 (2012). 128. Smith, B. N. et al. Exome-wide Rare Variant Analysis Identifies TUBA4A Mutations As- sociated with Familial ALS. Neuron 84, 324–331 (2014). 129. Chernov, K. G. et al. Role of Microtubules in Stress Granule Assembly: MICROTUBULE DYNAMICAL INSTABILITY FAVORS THE FORMATION OF MICROMETRIC STRESS GRANULES IN CELLS. Journal of Biological Chemistry 284, 36569–36580 (2009). 239 9 Bibliography 130. Nadezhdina, E. S., Lomakin, A. J., Shpilman, A. A., Chudinova, E. M. & Ivanov, P. A. Mi- crotubules govern stress granule mobility and dynamics. Biochimica et Biophysica Acta (BBA) - Molecular Cell Research 1803, 361–371 (2010). 131. Gentile, F. et al. The Peripheral Nervous System in Amyotrophic Lateral Sclerosis: Op- portunities for Translational Research. Frontiers in Neuroscience 13 (2019). 132. Murakami, T. et al. ALS/FTD Mutation-Induced Phase Transition of FUS Liquid Droplets and Reversible Hydrogels into Irreversible Hydrogels Impairs RNP Granule Function. Neuron 88, 678–690 (2015). 133. Dormann, D. et al. ALS-associated fused in sarcoma (FUS) mutations disrupt Transportin- mediated nuclear import. The EMBO Journal 29, 2841–2857 (2010). 134. Ash, P. E., Vanderweyde, T. E., Youmans, K. L., Apicco, D. J. & Wolozin, B. Pathological stress granules in Alzheimer’s disease. Brain Research 1584, 52–58 (2014). 135. Vanderweyde, T. et al. Contrasting Pathology of the Stress Granule Proteins TIA-1 and G3BP in Tauopathies. Journal of Neuroscience 32, 8270–8283 (2012). 136. Doñate-Macián, P. et al. The TRPV4 channel links calcium influx to DDX3X activity and viral infectivity. Nature Communications 9 (2018). 137. Lennox, A. L. et al. Pathogenic DDX3X Mutations Impair RNA Metabolism and Neuroge- nesis during Fetal Cortical Development. Neuron 106, 404–420.e8 (2020). 138. Samir, P. et al. DDX3X acts as a live-or-die checkpoint in stressed cells by regulating NLRP3 inflammasome. Nature 573, 590–594 (2019). 139. Snijders Blok, L. et al. Mutations in DDX3X Are a Common Cause of Unexplained Intel- lectual Disability with Gender-Specific Effects on Wnt Signaling. The American Journal of Human Genetics 97, 343–352 (2015). 140. Oughtred, R. et al. The BioGRID database: A comprehensive biomedical resource of curated protein, genetic, and chemical interactions. Protein Science: A Publication of the Protein Society 30, 187–200 (2021). 141. Bader, G. D. & Hogue, C. W. Analyzing yeast protein–protein interaction data obtained from different sources. Nature Biotechnology 20, 991–997 (2002). 142. Epling, L. B., Grace, C. R., Lowe, B. R., Partridge, J. F. & Enemark, E. J. Cancer- Associated Mutants of RNA Helicase DDX3X Are Defective in RNA-Stimulated ATP Hy- drolysis. Journal of Molecular Biology 427, 1779–1796 (2015). 240 9 Bibliography 143. Mitrovic, S.-A. Structural investigations of the TRPV4 intrinsically disordered N-terminus and structural studies of MIP-inhibitor interactions. PhD thesis (Johannes-Gutenberg University, Mainz, 2019). 144. Song, H. & Ji, X. The mechanism of RNA duplex recognition and unwinding by DEAD- box helicase DDX3X. Nature Communications 10 (2019). 145. Hellmann, N. & Schneider, D. in Protein Supersecondary Structures (ed Kister, A. E.) Series Title: Methods in Molecular Biology, 379–401 (Springer New York, New York, NY, 2019). 146. Mascotti, D. P. & Lohman, T. M. Thermodynamics of single-stranded RNA binding to oligolysines containing tryptophan. Biochemistry 31, 8932–8946 (1992). 147. Robinson, K. E., Orans, J., Kovach, A. R., Link, T. M. & Brennan, R. G. Mapping Hfq-RNA interaction surfaces using tryptophan fluorescence quenching. Nucleic Acids Research 42, 2736–2749 (2014). 148. Floor, S. N., Condon, K. J., Sharma, D., Jankowsky, E. & Doudna, J. A. Autoinhibitory Interdomain Interactions and Subfamily-specific Extensions Redefine the Catalytic Core of the Human DEAD-box Protein DDX3. Journal of Biological Chemistry 291, 2412–2421 (2016). 149. Wheeler, J. R., Matheny, T., Jain, S., Abrisch, R. & Parker, R. Distinct stages in stress granule assembly and disassembly. eLife 5 (2016). 150. Protter, D. S. & Parker, R. Principles and Properties of Stress Granules. Trends in Cell Biology 26, 668–679 (2016). 151. Wolozin, B. & Ivanov, P. Stress granules and neurodegeneration. Nature Reviews Neu- roscience 20, 649–666 (2019). 152. Thorneloe, K. S. et al. N-((1S)-1- -3-hydroxypropanoyl)-1-piperazinyl]carbonyl)-3-methylbutyl)- 1-benzothiophene-2-carboxamide (GSK1016790A), a Novel and Potent Transient Re- ceptor Potential Vanilloid 4 Channel Agonist Induces Urinary Bladder Contraction and Hyperactivity: Part I. Journal of Pharmacology and Experimental Therapeutics 326, 432– 442 (2008). 153. Willette, R. N. et al. Systemic Activation of the Transient Receptor Potential Vanilloid Subtype 4 Channel Causes Endothelial Failure and Circulatory Collapse: Part 2. Journal of Pharmacology and Experimental Therapeutics 326, 443–452 (2008). 241 9 Bibliography 154. Modregger, J., Ritter, B., Witter, B., Paulsson, M. & Plomann, M. All three PACSIN iso- forms bind to endocytic proteins and inhibit endocytosis. Journal of Cell Science 113 Pt 24, 4511–4521 (2000). 155. Toescu, E. C. & Verkhratsky, A. The importance of being subtle: small changes in calcium homeostasis control cognitive decline in normal aging. Aging Cell 6, 267–273 (2007). 156. Wang, Q. et al. Molecular mechanism of membrane constriction and tubulation medi- ated by the F-BAR protein Pacsin/Syndapin. Proceedings of the National Academy of Sciences 106, 12700–12705 (2009). 157. Rao, Y. et al. Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Proceedings of the National Academy of Sciences 107, 8213–8218 (2010). 158. Caires, R. et al. Omega-3 Fatty Acids Modulate TRPV4 Function through Plasma Mem- brane Remodeling. Cell Reports 21, 246–258 (2017). 159. Bai, X., Meng, G., Luo, M. & Zheng, X. Rigidity of Wedge Loop in PACSIN 3 Protein Is a Key Factor in Dictating Diameters of Tubules. Journal of Biological Chemistry 287, 22387–22396 (2012). 160. Goh, S. L., Wang, Q., Byrnes, L. J. & Sondermann, H. Versatile Membrane Deformation Potential of Activated Pacsin. PLoS ONE 7 (ed Johannes, L.) e51628 (2012). 161. Ryskamp, D. A. et al. TRPV4 regulates calcium homeostasis, cytoskeletal remodeling, conventional outflow and intraocular pressure in the mammalian eye. Scientific Reports 6, 30583 (2016). 162. Lee, W. H. et al. TRPV4 Regulates Breast Cancer Cell Extravasation, Stiffness and Actin Cortex. Scientific Reports 6 (2016). 163. Shin, S. H. et al. Phosphorylation on the Ser 824 residue of TRPV4 prefers to bind with F-actin than with microtubules to expand the cell surface area. Cellular Signalling 24, 641–651 (2012). 164. Becker, D., Müller, M., Leuner, K. & Jendrach, M. The C-terminal domain of TRPV4 is essential for plasma membrane localization. Molecular Membrane Biology 25, 139–151 (2008). 165. Becker, D., Bereiter-Hahn, J. & Jendrach, M. Functional interaction of the cation channel transient receptor potential vanilloid 4 (TRPV4) and actin in volume regulation. European Journal of Cell Biology 88, 141–152 (2009). 242 9 Bibliography 166. Spiering, D. & Hodgson, L. Dynamics of the Rho-family small GTPases in actin regulation and motility. Cell Adhesion & Migration 5, 170–180 (2011). 167. Dupraz, S. et al. RhoA Controls Axon Extension Independent of Specification in the Developing Brain. Current biology: CB 29, 3874–3886.e9 (2019). 168. Luo, L. Rho GTPases in neuronal morphogenesis. Nature Reviews. Neuroscience 1, 173–180 (2000). 169. Schaefer, A., Reinhard, N. R. & Hordijk, P. L. Toward understanding RhoGTPase speci- ficity: structure, function and local activation. Small GTPases 5, 6 (2014). 170. Gasmi-Seabrook, G. M. C. et al. Real-time NMR Study of Guanine Nucleotide Exchange and Activation of RhoA by PDZ-RhoGEF. Journal of Biological Chemistry 285, 5137– 5145 (2010). 171. Wei, Y. et al. Crystal structure of RhoA–GDP and its functional implications. Nature Struc- tural Biology 4, 699–703 (1997). 172. Wegierski, T., Hill, K., Schaefer, M. & Walz, G. The HECT ubiquitin ligase AIP4 regulates the cell surface expression of select TRP channels. The EMBO Journal 25, 5659–5669 (2006). 173. Shukla, A. K. et al. Arresting a Transient Receptor Potential (TRP) Channel: beta-ARRESTIN 1 MEDIATES UBIQUITINATION AND FUNCTIONAL DOWN-REGULATION OF TRPV4. Journal of Biological Chemistry 285, 30115–30125 (2010). 174. Zhang, D. & Aravind, L. Identification of novel families and classification of the C2 do- main superfamily elucidate the origin and evolution of membrane targeting activities in eukaryotes. Gene 469, 18–30 (2010). 175. Zhu, K. et al. Allosteric auto-inhibition and activation of the Nedd4 family E3 ligase Itch. EMBO reports 18, 1618–1630 (2017). 176. Shaw, A. Z. et al. Phosphorylation of either Ser16 or Thr30 does not disrupt the structure of the Itch E3 ubiquitin ligase third WW domain. Proteins 60, 558–560 (2005). 177. Chen, Z. et al. A Tunable Brake for HECT Ubiquitin Ligases. Molecular Cell 66, 345– 357.e6 (2017). 178. Melino, G. et al. Itch: a HECT-type E3 ligase regulating immunity, skin and cancer. Cell Death & Differentiation 15, 1103–1112 (2008). 243 9 Bibliography 179. Riling, C. et al. Itch WW Domains Inhibit Its E3 Ubiquitin Ligase Activity by Blocking E2- E3 Ligase Trans-thiolation. Journal of Biological Chemistry 290, 23875–23887 (2015). 180. Polo, S. et al. A single motif responsible for ubiquitin recognition and monoubiquitination in endocytic proteins. Nature 416, 451–455 (2002). 181. Shih, S. C., Sloper-Mould, K. E. & Hicke, L. Monoubiquitin carries a novel internalization signal that is appended to activated receptors. The EMBO Journal 19, 187–198 (2000). 182. Lorenz, S., Cantor, A. J., Rape, M. & Kuriyan, J. Macromolecular juggling by ubiquityla- tion enzymes. BMC biology 11, 65 (2013). 183. Takahashi, N. et al. TRPV4 channel activity is modulated by direct interaction of the ankyrin domain to PI(4,5)P2. Nature Communications 5, 4994 (2014). 184. Harraz, O. F., Longden, T. A., Hill-Eubanks, D. & Nelson, M. T. PIP2 depletion promotes TRPV4 channel activity in mouse brain capillary endothelial cells. eLife 7, e38689 (2018). 185. Goswami, C., Kuhn, J., Heppenstall, P. A. & Hucho, T. Importance of Non-Selective Cation Channel TRPV4 Interaction with Cytoskeleton and Their Reciprocal Regulations in Cultured Cells. PLoS ONE 5 (ed Matsunami, H.) e11654 (2010). 186. Martin, E. et al. Involvement of TRPV1 and TRPV4 channels in migration of rat pul- monary arterial smooth muscle cells. Pflügers Archiv - European Journal of Physiology 464, 261–272 (2012). 187. Fiorio Pla, A. et al. TRPV4 mediates tumor-derived endothelial cell migration via arachi- donic acid-activated actin remodeling. Oncogene 31, 200–212 (2012). 188. Dunn, K. W., Kamocka, M. M. & McDonald, J. H. A practical guide to evaluating colo- calization in biological microscopy. American Journal of Physiology-Cell Physiology 300, C723–C742 (2011). 189. Costes, S. V. et al. Automatic and quantitative measurement of protein-protein colocal- ization in live cells. Biophysical Journal 86, 3993–4003 (2004). 190. Ujfalusi-Pozsonyi, K. et al. The effects of detergents on the polymerization properties of actin. Cytometry Part A (2010). 191. Pugh, T. J. et al. Medulloblastoma exome sequencing uncovers subtype-specific somatic mutations. Nature 488, 106–110 (2012). 244 9 Bibliography 192. Kellaris, G. et al. A hypomorphic inherited pathogenic variant in DDX3X causes male in- tellectual disability with additional neurodevelopmental and neurodegenerative features. Human Genomics 12, 11 (2018). 193. Wang, X. et al. Phenotypic expansion in DDX3X - a common cause of intellectual dis- ability in females. Annals of Clinical and Translational Neurology 5, 1277–1285 (2018). 194. Nicola, P. et al. De novo DDX3X missense variants in males appear viable and contribute to syndromic intellectual disability. American Journal of Medical Genetics. Part A 179, 570–578 (2019). 195. Jones, D. T. W. et al. Dissecting the genomic complexity underlying medulloblastoma. Nature 488, 100–105 (2012). 196. Perfetto, M., Xu, X., Yousaf, N., Li, J. & Wei, S. The RNA helicase DDX3 induces neural crest by promoting AKT activity. preprint (Developmental Biology, 2019). 197. Lennox, A. L. et al. Pathogenic mutations impair RNA metabolism and neurogenesis during fetal cortical development. bioRxiv (2018). 198. Yang, S. N. Y. et al. RK-33 Is a Broad-Spectrum Antiviral Agent That Targets DEAD-Box RNA Helicase DDX3X. Cells 9 (2020). 199. Phung, B. et al. The X-Linked DDX3X RNA Helicase Dictates Translation Reprogram- ming and Metastasis in Melanoma. Cell Reports 27, 3573–3586.e7 (2019). 200. Saito, M. et al. Acetylation of intrinsically disordered regions regulates phase separation. Nature Chemical Biology 15, 51–61 (2019). 201. Lai, M.-C., Lee, Y.-H. W. & Tarn, W.-Y. The DEAD-box RNA helicase DDX3 associates with export messenger ribonucleoproteins as well as tip-associated protein and partici- pates in translational control. Molecular Biology of the Cell 19, 3847–3858 (2008). 202. Soto-Rifo, R. et al. DEAD-box protein DDX3 associates with eIF4F to promote translation of selected mRNAs. The EMBO journal 31, 3745–3756 (2012). 203. Choi, Y.-J. & Lee, S.-G. The DEAD-box RNA helicase DDX3 interacts with DDX5, co- localizes with it in the cytoplasm during the G2/M phase of the cycle, and affects its shuttling during mRNP export. Journal of Cellular Biochemistry 113, 985–996 (2012). 204. Lee, A. K. et al. Translational Repression of G3BP in Cancer and Germ Cells Suppresses Stress Granules and Enhances Stress Tolerance. Molecular Cell 79, 645–659.e9 (2020). 245 9 Bibliography 205. Marmor-Kollet, H. et al. Spatiotemporal Proteomic Analysis of Stress Granule Disassem- bly Using APEX Reveals Regulation by SUMOylation and Links to ALS Pathogenesis. Molecular Cell 80, 876–891.e6 (2020). 206. Jønson, L. et al. Molecular Composition of IMP1 Ribonucleoprotein Granules. Molecular & Cellular Proteomics 6, 798–811 (2007). 207. Thomas, M. G., Tosar, L. J. M., Desbats, M. A., Leishman, C. C. & Boccaccio, G. L. Mammalian Staufen 1 is recruited to stress granules and impairs their assembly. Journal of Cell Science 122, 563–573 (2009). 208. Burgess, H. M. et al. Nuclear relocalisation of cytoplasmic poly(A)-binding proteins PABP1 and PABP4 in response to UV irradiation reveals mRNA-dependent export of metazoan PABPs. Journal of Cell Science 124, 3344–3355 (2011). 209. Mazroui, R. Trapping of messenger RNA by Fragile X Mental Retardation protein into cy- toplasmic granules induces translation repression. Human Molecular Genetics 11, 3007– 3017 (2002). 210. Villace, P. The composition of Staufen-containing RNA granules from human cells indi- cates their role in the regulated transport and translation of messenger RNAs. Nucleic Acids Research 32, 2411–2420 (2004). 211. Yang, P. et al. G3BP1 Is a Tunable Switch that Triggers Phase Separation to Assemble Stress Granules. Cell 181, 325–345.e28 (2020). 212. Sfakianos, A. P. et al. The mTOR-S6 kinase pathway promotes stress granule assembly. Cell Death & Differentiation 25, 1766–1780 (2018). 213. Somasekharan, S. P. et al. YB-1 regulates stress granule formation and tumor progres- sion by translationally activating G3BP1. Journal of Cell Biology 208, 913–929 (2015). 214. Vascotto, C. et al. APE1/Ref-1 Interacts with NPM1 within Nucleoli and Plays a Role in the rRNA Quality Control Process. Molecular and Cellular Biology 29, 1834–1854 (2009). 215. Hubstenberger, A. et al. P-Body Purification Reveals the Condensation of Repressed mRNA Regulons. Molecular Cell 68, 144–157.e5 (2017). 216. Dammer, E. B. et al. Coaggregation of RNA-Binding Proteins in a Model of TDP-43 Proteinopathy with Selective RGG Motif Methylation and a Role for RRM1 Ubiquitination. PLoS ONE 7 (ed Iijima, K. M.) e38658 (2012). 246 9 Bibliography 217. Furukawa, M. T., Sakamoto, H. & Inoue, K. Interaction and colocalization of HERMES/RBPMS with NonO, PSF, and G3BP1 in neuronal cytoplasmic RNP granules in mouse retinal line cells. Genes to Cells 20, 257–266 (2015). 218. Tsai, N.-P., Tsui, Y.-C. & Wei, L.-N. Dynein motor contributes to stress granule dynamics in primary neurons. Neuroscience 159, 647–656 (2009). 219. Guil, S., Long, J. C. & Cáceres, J. F. hnRNP A1 Relocalization to the Stress Granules Reflects a Role in the Stress Response. Molecular and Cellular Biology 26, 5744–5758 (2006). 220. Mackenzie, I. R. et al. TIA1 Mutations in Amyotrophic Lateral Sclerosis and Frontotem- poral Dementia Promote Phase Separation and Alter Stress Granule Dynamics. Neuron 95, 808–816.e9 (2017). 221. Huang, C. et al. UBAP2L arginine methylation by PRMT1 modulates stress granule as- sembly. Cell Death & Differentiation 27, 227–241 (2020). 222. Fu, Y. & Zhuang, X. m6A-binding YTHDF proteins promote stress granule formation. Nature Chemical Biology 16, 955–963 (2020). 223. Matsuki, H. et al. Both G3BP1 and G3BP2 contribute to stress granule formation. Genes to Cells: Devoted to Molecular & Cellular Mechanisms 18, 135–146 (2013). 224. Kobayashi, T., Winslow, S., Sunesson, L., Hellman, U. & Larsson, C. PKCalpha Binds G3BP2 and Regulates Stress Granule Formation Following Cellular Stress. PLoS ONE 7 (ed Kahle, P. J.) e35820 (2012). 225. Li, C. H., Ohn, T., Ivanov, P., Tisdale, S. & Anderson, P. eIF5A promotes translation elongation, polysome disassembly and stress granule assembly. PloS One 5, e9942 (2010). 226. Thomas, M. G. et al. Staufen Recruitment into Stress Granules Does Not Affect Early mRNA Transport in Oligodendrocytes. Molecular Biology of the Cell 16, 405–420 (2005). 227. Goodier, J. L., Zhang, L., Vetter, M. R. & Kazazian, H. H. LINE-1 ORF1 Protein Localizes in Stress Granules with Other RNA-Binding Proteins, Including Components of RNA In- terference RNA-Induced Silencing Complex. Molecular and Cellular Biology 27, 6469– 6483 (2007). 228. Hamada, T. et al. Stress granule formation is induced by a threshold temperature rather than a temperature difference in Arabidopsis. Journal of Cell Science 131, jcs216051 (2018). 247 9 Bibliography 229. Wang, W., Zhang, X., Gao, Q. & Xu, H. TRPML1: an ion channel in the lysosome. Hand- book of Experimental Pharmacology 222, 631–645 (2014). 230. Desrochers, G. et al. Molecular basis of interactions between SH3 domain-containing proteins and the proline-rich region of the ubiquitin ligase Itch. Journal of Biological Chemistry 292, 6325–6338 (2017). 248 Curriculum Vitae Education and Research Experience Jan 2019 – Visiting researcher at the research group of Prof. , Johns Jun 2019 Hopkins University, USA (Fulbright Fellowship). “The impact of selected TRPV4 interactors upon TRPV4 mediated Ca2+-influx activity” Live Ca2+-influx imaging in cellulo. Immunostaining and subsequent confocal microscopy. Mouse studies on peripheral neuropathies. Since Apr PhD candidate in chemistry (TransMED as well as Sybille Kalkhof Rose- 2017 Fellowship), Johannes Gutenberg-University (JGU) Mainz “Elucidating molecular details in the interactome of the human ion channel TRPV4” Investigation of direct protein-protein interactions (PPI) via UDMSE, NMR and analytical FPLC. Indirect PPI studies via co-IPs and microscopical co-localization studies. Developing an in-house software for microscopical co-localization analysis. Jun 2016 – Master-Thesis, “Investigating the interactome of the TRPV4 N-terminus”, Apr 2017 JGU Mainz Recombinant expression of human proteins in E. coli, P. pastoris and HEK293T cells. Purification via several chromatographic methods, including preparative FPLC. Confirming structural protein integrity via CD spectroscopy and 2D-NMR. Apr 2015 – Research internship, “AOM-induced colorectal carcinogenesis in PARP-1 k.o. Jun 2015 mice”, JGU Mainz Inducing colorectal cancer in PARP-1 k.o. mice. Evaluation of carcinogenesis in vivo via colonoscopy. Immunohistostaining of colorectal tissues and subsequent confocal microscopy. ELISAs for TNF level determination. Oct 2014 – Studies in Biomedical Chemistry (M.Sc.), JGU Mainz Apr 2017 Elective subjects: Pharmacology, Oncology Apr 2014 – Student staff member at the IMG Innovations-Management GmbH Mar 2016 Novelty assessment of inventions with focus on industrial property rights in life science and chemistry. Composition of technological summaries of approved patents in English and German. Acquisition of technology licensees. Apr 2014 – Bachelor-Thesis, “Influence of disulfide compounds on the tumor-supressor Sep 2014 protein p53”, JGU Mainz Cell culture with colorectal cancer cell lines. ELISAs, EMSAs with subsequent Western- and Southern blotting. Recombinant expression of human proteins in Sf9 insect cells via baculoviruses Oct 2013 – Interdisciplinary advanced seminar “Tumor biology, oncological dia-gnostics and Apr 2014 novel therapies”, JGU Mainz July 2012 Extracurricular research internship, “Expression level of CD91 in leukemic stem cells”, JGU Mainz Cell culture with suspension cells, FACS Oct 2010 – Studies in Biomedical Chemistry (B.Sc.), JGU Mainz Sep 2014 Elective subject: Genotoxicology Mar 2010 Higher education entrance qualification, “Abitur” Gymnasium Kusel Awards Nov 2019 Sybille Kalkhof Rose-Stiftung Fellowship Sep 2019 Best Talk Award of a young researcher by the association frei für forschung – Neue Wege in der Medizin e.V. at the 6th TransMED ScienceDay, JGU Mainz Sep 2018 Science Award by the association frei für forschung – Neue Wege in der Medizin e.V. at the CRISPR Genome Editing Workshop, JGU Mainz Aug 2018 Fulbright Fellowship Mar 2018 Best Presentation Award at the 3rd Interdisciplinary symposium JGU Mainz Oct 2017 TransMED – Mainz Research School of Translational Biomedicine Fellowship Organizing and Teaching Experience Oct 2017+ Conference conception and organization of 2nd BioChem Symposium and 3rd Life Apr 2018 Science Meeting, JGU Mainz since Apr Supervision of 9 undergraduate students during their Bachelor and Master theses 2017 in (biomedical) chemistry. Conception and lecturing of undergraduate literature seminars and practical courses in “Biochemistry 2” Oct 2011 – Undergraduate research assistant, JGU Mainz Oct 2012 Conception, supervision and correction of exams in the subject “Allgemeine und anorganische Chemie I”. List of publications • McCray BA, Diehl E, Sullivan JM, Aisenberg WH, Zaccor NW, Lau AR, Goretzki B, Hellmich UA, Llyod TE, Sumner CJ. „Neuropathy-causing TRPV4 mutations disrupt TRPV4-RhoA interactions and impair actin cytoskeleton regulation“ (Nature Communications 12, 1444 (2021) • Wesenberg LJ, Diehl E, Zähringer TJB, Schollmeyer D, Shimizu A, Yoshida J, Hellmich UA, Waldvogel SR. „Twofold Electrochemical C,H-Amination of Activated Benzene Derivatives“ (Accepted, Chemistry – A European Journal) • Neitzel, C., Seiwert, N., Göder, A., Diehl, E, Weber, C., Nagel, G., Stroh, S., Rasenberger, B., Christmann, M., and Fahrer, J. (2019). Lipoic Acid Synergizes with Antineoplastic Drugs in Colorectal Cancer by Targeting p53 for Proteasomal Degradation. Cells 8, 794 (2019) • Wagner A, Le TA, Brennich M, Klein P, Bader N, Diehl E, Paszek D, Weickhmann AK, Dirdjaja N, Krauth-Siegel RL. Inhibitor-Induced Dimerization of an Essential Oxidoreductase from African Trypanosomes. Angewandte der Chemie International Edition 58, 3640–3644. (2019) • Goretzki B, Glogowski NA, Diehl E, Durchardt-Ferner E, Hacker C, Gaudet R, Hellmich UA. Structural Basis of TRPV4 N-Terminus Interaction with Syndapin/PACSIN1-3 and PIP2. Structure 26, 1583-1593.e5 (2018). • Dörsam B, Seiwerth S, Foersch S, Stroh S, Nagel G, Begaliew D, Diehl E, Kraus A, McKeague M, Minneker V, Roukos V, Reißig S, Waisman A, Moehler M, Stier A, Mangerich A, Dantzer F, Kaina B and Fahrer, J. PARP-1 protects against colorectal tumor induction, but promotes inflammation-driven colorectal tumor progression. Proc. Nat. Acad. Sci. 115, E4061–E4070 (2018). • Wagner A, Diehl E, Krauth-Siegel RL, Hellmich UA. Backbone NMR assignment of tryparedoxin, the central protein in the hydroperoxide detoxification cascade of African trypanosomes, in the oxidized and reduced form. Biomol NMR Assign. Volume 11, Issue 2, pp 193-196 (2017) Supervised theses Jul 2020 – – Bachelor thesis “A biochemical study of selected TRPV4 Oct 2020 interaction partners” Jun2018 – Diploma thesis “Investigating the Interactome of the Human Ion Channel Mar 2019 TRPV4 and Associated Channelopathies” Oct 2017 – – Bachelor thesis “Biochemische Studien an Ankyrin Repeat Jan 2018 Domains von TRPV-Ionenkanälen” Conference contributions (Selection) Sep 2019 6th TransMed Science Day, JGU Mainz “Towards elucidating the channelopathy interactome of the human ion channel TRPV4” (talk) Sep 2018 Laureate lecture at the CRISPR Genome Editing Workshop, JGU Mainz “Why CRISPR? A TR(i)P through the interactome world of the Transient Receptor Potential channel 4” Mar 2018 3rd Interdisciplinary Symposium, JGU Mainz “Transient receptor potential channels – Building a bridge between Aristotle and chili” (talk)